KEGG   Rattus norvegicus (rat): 266712
Entry
266712            CDS       T01003                                 

Gene name
Rnf40
Definition
(RefSeq) ring finger protein 40
  KO
K10696  E3 ubiquitin-protein ligase BRE1 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    266712 (Rnf40)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     266712 (Rnf40)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   BRE1 proteins
    266712 (Rnf40)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-C3HC4 KASH_CCD BRE1 EzrA zf-C3HC4_2 zf-RING_5 zf-RING_2 zf-RING_UBOX Prok-RING_4 zf-rbx1 SpoIIE
Other DBs
NCBI-GeneID: 266712
NCBI-ProteinID: NP_703201
RGD: 628638
Ensembl: ENSRNOG00000018840
UniProt: Q8CJB9
Position
1q37
AA seq 1002 aa
MSGLSNKRAAGDGGSGPPEKKLNREEKTTTTLIEPIRLGGISSTEEMDSKVLQFKNKKLA
ERLEQRQACEDELRERIEKLEKRQATDDATLLIVNRYWAQLDETVEALLQCYENQRELSS
SGTEVPGCQEGLTRDVIPRTDPGTSDLREPLPMQFRAPLSEPALAFVVALGASSCEEVEL
QLQGRMEFSKAAVSRVVEASDRLQRQVEELCQRVYSRGDSEAPGEVARARTRELGRENRR
LQDLATQLQEKHHRISLEYSELQDKVTSTETKVLEMETTVEDLQWDIEKLRKREQKLNKH
LAEALEQLNSGYYVSGSSTGFQGGQITLSMQKFEMLNAELEENQELANSRMAELEKLQAE
LQGAVRTNERLKVALRSLPEEVVRETGEYRMLQAQFSLLYNESLQVKTQLDEARGLLLAS
KNSHLRHIEHMESDELGLQKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQNLAANEQAGPI
NREMRHLISSLQNHNHQLKGDAQRYKRKLREVQAEIGKLRAQASGSSHCGPNLSHPDDSG
LNALAPGKEDSGPGPGGTPDSKKELALVAGATSVASSVKKEELVSSEDDAQALAPGTQGL
PSRGREPEARPKRELREREGPSLGPPPAASTLSRADREKAKAEEARRKESELLKGLRAEL
KKAQESQKEMKLLLDMYKSAPKEQRDKVQLMAAERKAKAEVDELRSRIRDLEERDRRESK
KIADEDALRRIRQAEEQIEHLQRKLGATKQEEEALLSEMDVTGQAFEDMQEQNGRLLQQL
REKDDANFKLMSERIKANQIHKLLREEKDELGEQVLGLKSQVDAQLLTVQKLEEKERALQ
GSLGGVEKELTLRSQALELNKRKAVEAAQLAEDLKVQLEHVQTRLREIQPCLAESRAARE
KESFNLKRAQEDISRLRRKLEKQRKVEVYADADEILQEEIKEYKARLTCPCCNTRKKDAV
LTKCFHVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRVYIS
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgtctggcctcagcaacaagcgcgccgccggcgacgggggctcaggacccccagagaag
aagctgaaccgcgaggagaagactacgaccactctaatcgagcccattcgtctcgggggc
atttcttccacggaggagatggattccaaggtgctgcagtttaagaataagaagctggcg
gagcggctggagcagcggcaagcctgtgaggacgagctccgggagagaattgagaaattg
gagaagaggcaggccacggacgatgccacactcctcatcgtcaaccgctactgggcccag
ctggatgaaactgtagaagcccttctccagtgctacgagaaccagagggagctgtcttca
tcagggacagaggtgcctgggtgccaagagggcctaacccgtgatgtgatccctcgaaca
gatccagggacatcagatctgagggaaccactgccgatgcagttccgagcccctctcagt
gagccagccttggcttttgtggtggcactgggcgccagcagctgtgaggaagtagagctg
cagctgcagggtcgcatggaattctccaaggctgctgtgtctcgggtggtagaggcctcg
gaccgcctacagcgtcaggtggaagaactctgtcagcgagtatacagccggggggacagt
gaggcgcccggggaggtggcacgggcacgcacccgggaactaggcagagagaaccgtagg
ctacaggacttggccactcagctgcaggagaagcaccaccgcatctcgttggagtactct
gagctccaagacaaagtgacatcgacggagaccaaggtcctagagatggagacaacagtg
gaggacttacagtgggacatcgagaagctgcgcaagcgagaacagaagctcaataagcac
ttggcagaggccttggagcagctcaactctggctactatgtgtctgggagctccacgggc
tttcagggaggccagattacacttagcatgcagaagtttgagatgttgaatgcagagctg
gaagaaaatcaggaattggccaatagccgaatggcagagctcgagaagttacaggctgag
cttcagggggctgttcggaccaatgaacgtctcaaggtggccctgcgaagccttcctgag
gaggtcgttcgtgagacgggggagtaccgcatgctgcaggcccagttctcactgctctac
aatgagtctttgcaagtgaagacccagctagatgaggcccggggactgctgctggcctcc
aagaactcccacttgagacacatcgaacatatggagagcgatgagttggggctgcagaag
aagctgcgcacagaagttatccagctggaagacaccctggcccaggtacgcaaggagtac
gagatgctgcgcattgagtttgagcagaaccttgcggccaacgagcaggctgggcctatc
aaccgtgaaatgcgccacctgattagcagcctccagaaccacaatcaccagctaaaagga
gatgcccagcgatataagcggaaacttcgagaagtacaggctgagattggtaaactccgg
gcacaggccagcggctcttcccactgcggccccaacttgagccaccctgatgactctggc
ctcaatgcccttgccccagggaaagaagatagtgggcctggccctggaggcacccctgac
agcaagaaggagttggctttagtggcgggagctacgtctgttgcttcttccgtaaagaaa
gaggagctggtctcctccgaagatgatgcccaggccctagcccctggaacccagggcttg
ccctcccggggccgagaacctgaggccagacccaagcgagaacttcgggaacgggaaggg
cctagcctgggacccccacctgcagcctccactctgtccagggctgatcgagaaaaggcc
aaggcagaggaagccaggaggaaggaatcagaactgctcaaaggtctccgagcagagctc
aagaaggcccaggaaagccagaaggagatgaagctgctgctggacatgtacaagtccgca
cccaaggagcagcgggataaggtgcaactcatggcagctgaacggaaggccaaggccgag
gtggatgagcttcggagccgcatccgagacctggaagagagagaccgaagagaaagcaag
aagattgccgatgaggatgccctgcggcggatccggcaggcagaagagcagattgaacac
ttgcaacgcaaattgggtgcgaccaagcaggaggaagaggcactgctgtcggagatggat
gtgacaggtcaagcctttgaagacatgcaggagcaaaacgggcggctgctccagcagtta
cgggaaaaggatgacgccaactttaagctcatgtcagagaggatcaaggccaaccagatt
cacaagctgctccgagaagagaaggacgagttgggcgagcaggttcttggccttaagtcc
caggtggatgcccagctgttgacagtccagaagcttgaggaaaaggagcgggctctgcag
ggcagccttgggggtgtcgagaaggagttgacattgcgcagccaggccctggagcttaat
aagagaaaggctgtagaagcagcccagttggctgaggacctgaaggtgcagttggagcac
gtgcagactcggcttcgagagatccagccctgcctggcagagagccgggctgcccgggag
aaagagagcttcaacctcaagagagctcaggaggacatttcccggctgcggcgcaaacta
gagaaacagcggaaagtagaagtttatgcagatgcggatgagatcctgcaggaagagatc
aaggagtacaaggcccggctgacctgcccctgctgtaacacccgcaagaaggacgctgtg
cttaccaagtgcttccacgtcttctgctttgaatgcgtgcggggccgctatgaggcccgc
cagaggaagtgtcccaagtgcaacgctgcctttggtgcccacgacttccaccgtgtgtac
atcagctga

DBGET integrated database retrieval system