KEGG   Rattus norvegicus (rat): 266732
Entry
266732            CDS       T01003                                 

Gene name
Npc1
Definition
(RefSeq) Niemann-Pick C1 protein precursor
  KO
K12385  Niemann-Pick C1 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    266732 (Npc1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    266732 (Npc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    266732 (Npc1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC65: NPC-type cholesterol transporter
   266732 (Npc1)
SSDB
Motif
Pfam: Patched NPC1_N Sterol-sensing MMPL ACR_tran
Other DBs
NCBI-GeneID: 266732
NCBI-ProteinID: NP_705888
RGD: 628693
Ensembl: ENSRNOG00000012016
Vega: OTTRNOG00000002300
UniProt: G3V7K5
Position
18
AA seq 1278 aa
MGAHHPALGLLLLLLLCPAQVFSQSCVWYGECGVAFGDKRYNCEYSGPPKPLPKDGYDLV
QELCPGLFFGNVSLCCDVQQLQTLKSNLQLPLQFLSRCPSCFYNLMTLFCELTCSPHQSQ
FLNVTATEDYFDPETRENKTNVKELEYYVGRSFANAMYNACRDVEAPSSNEKALGLLCGR
DARACNATNWIEYMFNKDNGQAPFTIIPVFSDLSVLGMEPMRNATKGCNESVDEVTGPCS
CQDCSAVCGPKPQPPPPPVPWRILGLDAMYVIMWVAYMAFLVLFFGGLLAVWCHRRRYFV
SEYTPIDSNIAFSSNSSDKGEASCCDPLGVAFDDCLRRMFTKWGAFCVRNPTCIIFFSLV
FIAACSSGLVFVQVTTNPVELWSAPHSQARLEKEYFDKHFGPFFRTEQLIIQAPNSSVHI
YEPYPSGADVPFGPPLNKEILHQVLDLQIAIESITASYNNETVTLQDICVAPLSPYNKNC
TIMSVLNYFQNSHAVLDNQVGDDFFVYADYHTHFLYCVRAPASLNDTSLLHGPCLGTFGG
PVFPWLVLGGYDDQNYNNATALVITFPVNNYYNDTEKLQRAWAWEKEFINFVKNYKNPNL
TISFTAERSIEDELNRESNSDVFTVLISYAVMFLYISLALGHIQSWNRVLVDSKISLGIA
GILIVLSSVTCSLGIFSYIGMPLTLIVIEVIPFLVLAVGVDNIFILVQTYQRDERLQEET
LDQQLGRILGEVAPTMFLSSFSETSAFFFGALSSMPAVHTFSLFAGMAVLIDFLLQITCF
VSFLGLDIKRQEKNRLDILCCVRGPDDGQESQASESYLFRFFKNAFAPFLLTDWLRPVVM
AVFVGILSFSIAVVNKVEIGLDQSLSMPNDSYVIDYFKSLGQYLHSGPPVYFVLEEGYNY
SSRRGQNMVCGGMGCDNDSLVQQIFNAAELDTYTRVGFAPSSWIDDYFDWVSPQSSCCRL
YNVTHQFCNASVIDPTCVRCRPLTPEGKQRPQGKEFMKFLPMFLSDNPNPKCGKGGHAAY
SSAVNIMGDDTYIGATYFMTYHTILKTSADYIDALKKARLIASNITETMRSKGSDYRVFP
YSVFYVFYEQYLTIIDDAIFNLSVSLGSIFLVTLVALGCELWSAVIMCLTIAMILVNMFG
VMWLWGISLNAVSLVNLVMTCGISVEFCSHITRAFTMSTKGSRVSRAEEALAHMGSSVFS
GITLTKFGGIVVLAFAKSQIFEIFYFRMYLAMVLLGATHGLIFLPVLLSYIGPSVNKAKR
HTTQERYKGTERERLLNF
NT seq 3837 nt   +upstreamnt  +downstreamnt
atgggcgcgcaccacccggccctcggcctcctgctgctgctgctgctgtgccctgcgcag
gtgttctcacagtcctgtgtctggtacggagagtgtggagtcgcctttggagataagagg
tacaactgtgaatattcgggcccaccgaaacccctcccaaaggacggctatgacttagtg
caggaactctgtccaggactcttctttggcaatgtcagtctttgctgtgacgttcagcag
cttcagacactgaagagcaacctgcagctgcccctgcagtttctgtccaggtgtccgtca
tgtttttataacctgatgaccctgttttgtgagctaacatgtagcccgcaccagagtcag
tttctgaatgtgacagcaactgaagattatttcgaccccgagactcgggaaaataaaaca
aatgtaaaggaattagagtactacgtcggacggagctttgcgaatgcaatgtacaatgcc
tgccgagatgtggaggcgccttccagtaatgagaaggccttaggactcctgtgcggaagg
gatgcccgtgcctgcaatgccaccaactggattgagtacatgttcaacaaagacaacggg
caagcaccgtttaccatcatccccgtattttcagatctttcggttcttggaatggaaccc
atgaggaatgccaccaaaggctgcaacgagtctgtagatgaggtcacagggccgtgtagc
tgccaggactgctctgccgtctgcggccccaaaccccagcccccaccgccccctgtgccc
tggaggatcttaggtttggacgccatgtatgtcatcatgtgggtcgcctacatggcgttc
ctggtcctgttctttggaggactgctggcagtgtggtgccacagaaggcggtactttgtg
tccgagtacacccccattgacagcaacattgccttttcctcgaatagcagtgacaaaggg
gaagcctcgtgctgcgacccacttggtgtagcgtttgatgactgtctgaggcgcatgttc
acaaagtggggggctttctgtgtccggaatcccacctgcatcattttcttctcgttggtc
ttcattgctgcgtgctcttctggcctggtgtttgtccaggtcaccaccaatcccgtggag
ctctggtcagcccctcacagtcaggcccgcttggaaaaggagtactttgacaagcacttt
gggcctttctttcgtacggagcagcttattatccaggcccccaactccagcgtccatatc
tacgagccgtacccttccggagccgatgtgcccttcgggcctccattgaacaaagagatt
ctgcaccaggttctggacttacagatcgccattgaaagtatcactgcgtcctataacaat
gaaaccgtgacacttcaggacatctgtgtggcccccctctctccatacaacaagaactgc
accattatgagtgtgttaaattacttccagaacagccatgcggtgctggacaaccaagta
ggcgatgacttctttgtctatgccgattaccacacgcactttctgtactgtgtgagggct
cccgcctccttgaatgatacgagtttgctccacggcccttgcctgggcacatttggagga
cctgtgttcccgtggcttgtgttgggcggctatgatgatcagaactacaataatgccacc
gcgcttgtgattaccttccctgtcaataattactataatgacacagagaagctccagagg
gcctgggcctgggagaaagaatttattaactttgtgaagaactacaagaatccaaatctg
accatttctttcactgctgagcgaagcattgaagatgaactcaatcgggaaagcaacagt
gacgtattcaccgtcctcatcagctatgccgtgatgtttctgtacatttccctcgccctg
gggcacatccagagctggaacagggtcctggtggattctaaaatctcgctgggcattgcg
gggatcctgatagtgctgagctcggtgacctgctccctgggcatcttcagctacatcgga
atgccactgaccctcatcgtcattgaggtcatcccgttcctggtgctggctgttggggtg
gacaacatcttcattctagtgcagacctaccagagagatgagcgtcttcaggaggagacg
ttggatcagcagctgggcaggatcctgggggaagtggccccaaccatgttcctttcgtcc
ttctctgagacctcggcatttttctttggggcgctgtcctcgatgccagctgtccacacc
ttctctctgtttgcggggatggccgtcctcattgacttcctccttcagattacctgcttt
gtgagcttcttggggttagatattaagagacaagagaaaaaccgtctggacatcctgtgc
tgtgtcagaggccctgacgacggacaagaatcccaagcctccgaaagctacctgttccgc
ttcttcaaaaacgcctttgccccatttctgctgacggactggctgcggccagttgtgatg
gccgtgtttgtgggcattctgtcattcagtattgcagtagtgaacaaagtagaaatcgga
ttggatcagtctctctcgatgccaaatgattcgtatgtgattgactatttcaagtcactc
ggtcagtacctgcactcgggcccacccgtgtacttcgtcctggaagagggctacaactac
agttcccgcagagggcagaacatggtgtgcggtggcatgggctgtgacaatgactccctg
gtgcagcagatatttaacgcagcagagctggacacctacacccgcgtaggcttcgctccc
tcatcctggattgatgattactttgactgggtctcaccgcaatcctcctgctgtagactc
tacaatgtcactcaccagttctgcaatgcttctgtgattgacccaacctgtgtccgctgc
agacctctgactccagagggcaaacagaggcctcaggggaaagaattcatgaaattcctg
cccatgttcctgtctgataaccccaaccccaagtgtggcaaagggggacatgctgcttac
agttctgctgttaacatcatgggagatgacacttacattggggccacttacttcatgacc
taccacaccattcttaagacctctgctgattatatcgatgccctgaagaaagctcggctt
atagccagtaacatcacggaaaccatgcgttctaaggggagtgattatcgtgtgtttcct
tacagtgtgttctatgtcttctatgaacaatacctgaccattattgatgacgccatcttt
aacctaagtgtgtctctgggctccatatttctcgtgaccttggtggctctgggctgtgaa
ctgtggtctgcggtcatcatgtgtctcaccatagctatgatcctggtcaacatgtttggt
gttatgtggctgtggggcatcagtctgaacgctgtttccttggtcaacttggtgatgacc
tgtggcatttctgtggagttctgcagccatataacaagagctttcaccatgagcaccaaa
ggaagcagagtgagcagggcggaagaggcactggcccacatgggtagttctgtattcagt
ggaatcacacttacaaaatttggagggatcgtggtgttggcctttgccaagtctcaaatt
tttgagatcttttacttcaggatgtacttagccatggtcttacttggagctactcacgga
ctaatatttcttcccgtcttactcagttacatagggccatcagtgaataaagctaaaaga
cacaccactcaagagcggtacaaagggacagagagagaacggctcctcaatttttag

KEGG   Rattus norvegicus (rat): 286898
Entry
286898            CDS       T01003                                 

Gene name
Npc2
Definition
(RefSeq) epididymal secretory protein E1 precursor
  KO
K13443  Niemann-Pick C2 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    286898 (Npc2)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    286898 (Npc2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    286898 (Npc2)
Transporters [BR:rno02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   286898 (Npc2)
SSDB
Motif
Pfam: E1_DerP2_DerF2
Other DBs
NCBI-GeneID: 286898
NCBI-ProteinID: NP_775141
RGD: 628756
Ensembl: ENSRNOG00000012062
UniProt: F7FJQ3
Position
6
AA seq 152 aa
MPRMSFLTPTILLLALVAATQAEPLHFKDCGSKVGVIKEVNVSPCPTQPCQLHKGQSYSV
NVTFTSGTQSQNSTALVHGILAGVPVYFPIPEPDGCKCGINCPIQKDKVYSYLNKLPVKS
EYPSLKLVVEWKLQDDKKDNLFCWEIPVEIKG
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcccaggatgagcttcctgacccccacgatcctgctgctggcgctggtcgccgccacc
caggccgagcccctgcacttcaaggactgcggctctaaggtgggcgttataaaggaagtg
aatgtgagcccgtgccctacccagccctgtcagctacacaaaggccagtcctacagtgtc
aacgtcacctttactagcggcactcagtcccagaacagcacggccttggtccacggcatc
ttggcaggggtcccagtctacttccctattcctgagcctgacggttgtaaatgtggaatc
aactgccccatccagaaagacaaggtctacagctacctgaataagctgccggtgaagagc
gaatatccctctctaaaactggtggtggaatggaaacttcaagatgacaaaaaggataac
ctcttctgctgggagatcccagtagagatcaaaggctag

DBGET integrated database retrieval system