KEGG   Rattus norvegicus (rat): 266764Help
Entry
266764            CDS       T01003                                 

Gene name
Tbkbp1, Prosapip2
Definition
(RefSeq) TBK1 binding protein 1
  KO
K12652  TANK-binding kinase 1-binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    266764 (Tbkbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TBD Zn-C2H2_12 CT_C_D Seryl_tRNA_N Bacillus_HBL
Motif
Other DBs
NCBI-GeneID: 266764
NCBI-ProteinID: NP_742018
RGD: 631328
Ensembl: ENSRNOG00000009370
UniProt: Q6DG50
Position
10q31
AA seq 613 aa AA seqDB search
MESMFEDDISILTQEALGPSEVWLDGPGDPSLGGDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLITDFGEEHGFPLYEIKDGSLLEVEKVSLQQRLNQFQHELQKN
KEQEEQLGEMIQAYEKLCVEKSDLETELGEMRALVETHLRQICGLEKQLQQQQGLRDAAF
SSLSPPAVPATACPDLDLHYLALRGGPALGHAGWPGPTSVSVSELERRRLEEALEAAQGE
ARGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSECGMAWVKRVGDDQVNLALAYT
ELTEELGRLRELSSLQGRILRTLLQEQARNAGQRHSPLSQRHSPAPACPSPSPPARPPPC
APCQSPAAQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPSCQSPSPQRRSPVPPS
CPAPQPRPPPPPGERTLAERAYAKPPSHHAKAGFQGRRSYSELAEGAAYAAASPAWLQAE
AATLPKPRAYGGELYGPGRPLSPRRAFEGIRLRFEKQPSEEEEWAMPASPPSPEASTIRC
ASFCAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDDAL
IKHIDSHLENSKI
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggagtccatgtttgaagatgacatcagcatcctgacccaagaggccttggggcccagt
gaggtgtggctggatggtcctggagacccgtcactgggaggggacatgtgctctgcctcc
cattttgctctcatcacagcctatggagatatcaaagagcggctaggaggcctggagaga
gagaatgccaccctccgccgtcgcctcaaagtctatgagattaagtatccgctgatcacc
gattttggagaagagcatggcttccctctgtatgaaatcaaggatggctccctgctggag
gtggagaaggtcagtctgcagcaacggctcaatcagttccaacacgagttgcagaagaat
aaggagcaggaagaacagctcggggagatgatccaggcttacgagaaactgtgtgtggag
aaaagcgacctggagacagagctgggggagatgcgagctctggtagagacacacctacgg
cagatctgtggtttggagaaacagctgcagcaacagcaaggcctccgggatgcagctttc
tccagcctgagccccccagcggtccctgccacagcctgtcctgacctggacctgcactat
ctggctctgagagggggacctgccttgggtcatgcaggctggcctggccctaccagtgta
agtgtgagtgagttggagcggagacgcctggaagaggccctggaggctgcgcagggggag
gctcggggagctcagctccgggaggagcaactccaggcagaatgtgagcggcttcaggga
gagctgaagcagctgcaggagacccgggcccaggatctggcctccaaccagtcggaatgt
ggcatggcttgggtaaagagagttggggacgatcaggtgaacttggcactggcctataca
gaactgaccgaggagctgggtcgccttcgggagttgagttccctgcaggggaggatcttg
aggactttgctacaggaacaggcccgcaatgcaggccaaaggcactcaccgctgtcacaa
cgtcactccccggcccccgcgtgcccctcaccctccccacctgcccgaccgccgccctgt
gccccatgccagtcccccgctgcacagcgccgttcgcccgtgcccccgtgcccttcaccc
cagcagcgccgctcgcccgcctcgccgtcctgcccgtcgccggtcccacagcgccgctcg
ccggtgccgccgtcgtgccagtcgcccagtccgcagcgccgctcgcctgtgccacccagc
tgcccggccccgcagccccggccaccgccaccaccgggggagaggacgctggccgagcgt
gcctatgctaagccgcccagccaccacgccaaggccggcttccagggccgccgcagctac
tcggagctagcggagggggcggcctacgctgctgcctcccccgcctggctgcaggccgag
gctgccacgctccctaagccccgcgcctatggcggagagctctacggcccgggcaggccg
ctcagcccgcgccgagccttcgagggcatccgcttgcgctttgagaaacagccatcggag
gaagaggagtgggccatgcccgccagcccgcccagtcccgaggcgagcaccatccgctgc
gcctcattctgtgcgggcttccccatcccagagtcacctgcggccaccgcctatgcccac
gctgagcacgcacagtcctggccatccatcaatctactgatggagacggtgggctccgac
atccgaagttgccccctctgccagttgggtttccctgtcgggtacccagatgatgccctc
atcaaacacattgactcccacctggagaacagcaagatctag

DBGET integrated database retrieval system