KEGG   Rattus norvegicus (rat): 266766
Entry
266766            CDS       T01003                                 

Gene name
Rcan1
Definition
(RefSeq) calcipressin-1
  KO
K17901  calcipressin-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    266766 (Rcan1)
   04919 Thyroid hormone signaling pathway
    266766 (Rcan1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    266766 (Rcan1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    266766 (Rcan1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    266766 (Rcan1)
SSDB
Motif
Pfam: Calcipressin GOLD_2
Other DBs
NCBI-GeneID: 266766
NCBI-ProteinID: NP_714946
RGD: 631338
Ensembl: ENSRNOG00000001979
UniProt: Q6IN33
Position
11
AA seq 199 aa
MHFRDFNYNFSSLIACVANGDVFSESETRAKFESLFRTYDKDITFQYFKSFKRVRINFSN
PLSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQV
EDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEEEEEEEEEMERMKR
PKPKIIQTRRPEYTPIHLS
NT seq 600 nt   +upstreamnt  +downstreamnt
atgcattttagggactttaactacaattttagctccctgattgcctgtgtggcaaacggt
gatgtcttcagcgaaagtgagaccagggccaaatttgaatccctcttcaggacgtatgac
aaggacatcaccttccagtattttaagagcttcaagcgtgtccgaataaacttcagcaac
cccctgtctgcggcggacgccaggctgcagctgcataagacagagttcctggggaaggag
atgaaactgtactttgcccagactttacacataggaagttcacacctggctccgcccaat
ccagacaaacagtttctcatctctccccctgcctctccacctgttggctggaaacaagta
gaagacgctaccccagtcataaactacgatcttttatatgctatctccaagctgggacca
ggagagaagtacgagctacacgcagcgacagacaccacgcccagcgtggtggtccacgtg
tgtgagagtgaccaagaggaggaggaggaagaggaggaggagatggagagaatgaagaga
cccaagccaaaaatcatccagactcggaggccagagtacacacccatccacctcagctga

DBGET integrated database retrieval system