KEGG   Rattus norvegicus (rat): 266767Help
Entry
266767            CDS       T01003                                 

Gene name
Slc17a8, Vglut3
Definition
(RefSeq) solute carrier family 17 member 8
  KO
K12302  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    266767 (Slc17a8)
   04723 Retrograde endocannabinoid signaling
    266767 (Slc17a8)
   04721 Synaptic vesicle cycle
    266767 (Slc17a8)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    266767 (Slc17a8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    266767 (Slc17a8)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   266767 (Slc17a8)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    266767 (Slc17a8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 BT1
Motif
Other DBs
NCBI-GeneID: 266767
NCBI-ProteinID: NP_714947
RGD: 628870
Ensembl: ENSRNOG00000007581
Vega: OTTRNOG00000002178
UniProt: Q7TSF2
Position
7q13
AA seq 588 aa AA seqDB search
MPFNAFDTFKEKILKPGKEGVKNAVGDSLGILQRKLDGTNEEGDAIELSEEGRPVQTSRA
RAPVCDCSCCGIPKRYIIAVMSGLGFCISFGIRCNLGVAIVEMVNNSTVYVDGKPEIQTA
QFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARV
HYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGV
LVQYIGWASVFYIYGMFGIIWYMFWLLQAYECPAVHPTISNEERTYIETSIGEGANLASL
SKFNTPWRRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPH
MVMTIVVPIGGQLADYLRSRKILTTTAVRKIMNCGGFGMEATLLLVVGFSHTKGVAISFL
VLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKHKTREEW
QNVFLIAALVHYSGVIFYGVFASGEKQDWADPENLSEEKCGIIDQDELAEETELNHEAFV
SPRKKMSYGATTQNCEVQKTDRRQQRESAFEGEEPLSYQNEEDFSETS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgccatttaacgcatttgataccttcaaagaaaaaattttgaaacccgggaaggaagga
gtgaagaatgccgtgggagattcgctggggatcttacaaagaaaactcgatgggaccaac
gaggagggagatgccattgagctgagtgaggaaggaaggcccgtgcagacatccagagcc
cgagcccctgtgtgcgactgcagctgctgtggcatccccaagcggtacatcatcgctgtc
atgagtggcctgggattctgcatttcctttgggattcggtgcaaccttggagtggccatt
gtggaaatggtcaacaatagcactgtgtatgtggatgggaaaccggaaatccagacagca
cagtttaactgggatccagagacggtgggtcttatccatggatcttttttctggggttat
attgtgacacaaattcccggtggcttcatttcaaacaagtttgctgctaacagggtcttt
ggagctgccatcttcttgacgtcaaccctgaacatgttcatcccttccgcggccagggtg
cattacggctgtgtcatgtgtgtgaggattttgcagggtctggtggagggtgtgacctac
ccagcctgccacgggatgtggagtaagtgggcacctcccctggagagaagtcgtctagcc
acaacctctttttgtggttcctatgccggggcagtcgttgctatgccccttgcaggagta
ttggtgcagtacattggctgggcctctgtcttttatatttacgggatgtttggaattatt
tggtacatgttttggctgctgcaggcttatgagtgtccagcagttcacccaacaatatcc
aatgaagaacggacctacatagagacaagtataggagaaggcgccaacttggccagtctg
agcaaattcaacacaccatggagaaggtttttcacatccttgcctgtctatgccattatt
gtggcaaacttttgtagaagctggaccttctatttgctcttaataagtcagcctgcttac
tttgaagaggtctttgggtttgcaataagtaaggtgggtctcttgtcagctgtcccacac
atggtgatgacaatcgtggtacccattggaggacaactggctgattatttaagaagccga
aagattttgaccacaactgctgtcagaaagatcatgaattgtggaggctttggcatggag
gcaaccttgctcctggtggttgggttttcccataccaaaggagtggctatctccttcctg
gtgcttgctgtaggatttagtggctttgcaatttcaggtttcaatgtcaaccacctggac
attgctccacgatatgccagcatcctcatggggatctcaaatggcgtgggaaccctctct
ggaatggtttgtcccctcattgttggtgcaatgacaaagcacaagacccgggaagaatgg
cagaatgtgttcctcatagcagccctggtgcactacagtggagtcatcttctacggggtc
tttgcttctggggaaaaacaggactgggctgatccagagaatctctctgaggagaaatgt
ggaatcattgaccaagatgaattagccgaggaaacagaactcaaccacgaggctttcgta
agtcccagaaagaagatgtcttatggagccaccacccagaattgtgaggtccagaagacg
gatcggagacaacagagagaatccgccttcgagggggaggagccattatcctaccagaat
gaagaggacttttcagaaacatcttaa

DBGET integrated database retrieval system