KEGG   Rattus norvegicus (rat): 266777Help
Entry
266777            CDS       T01003                                 

Gene name
Nptx1
Definition
(RefSeq) neuronal pentraxin 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Pentaxin Laminin_G_3 MRP-S27 Laminin_G_2 Spc7 IL11 DUF848 DUF16 DUF3024 HSBP1
Motif
Other DBs
NCBI-GeneID: 266777
NCBI-ProteinID: NP_714957
RGD: 628894
Ensembl: ENSRNOG00000003741
UniProt: P47971
Position
10q32.3
AA seq 432 aa AA seqDB search
MLAGRAARTCALLALCLLGSRAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQ
LRETVLQQKETILSQKETIRELTTKLGRCESQSTLDAGPGEARSGGGRKQPGSGKNTMGD
LSRTPASETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSR
VNTLEEGKGGPKNDTEERAKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
AKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKV
AKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQD
TLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSSKALSGNVIAWAESQIEIFGGA
TKWTFEACRQIN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgctggccggccgcgccgcacgcacctgtgcgctgctcgccctctgcctcctgggcagt
cgggcccaggatttcgggccgacccgcttcatctgcacttcggtgccggtggacgccgac
atgtgtgccgcgtccgtggccgcgggcggcgcggaggagcttcggagcaatgtgctgcag
ctccgggagaccgtgctgcagcagaaggagaccatcctcagccagaaggagaccatcagg
gagctgaccaccaagcttggccgctgcgagagccagagcaccctggacgcgggtccgggc
gaggccaggtcgggcggcggccgcaagcagcctggctcgggcaagaatacgatgggcgac
ctgtcccggactccggcctcggagacgctcagccaactcgggcaaactttgcaatccctc
aaaacccgactggagaacctcgagcagtacagccgcctcaattcttccagccaaaccaac
agcctcaaggatctgctgcagagcaagatcgatgacctggagcggcaggtgctgtctcga
gtgaacactctggaggagggaaaagggggccccaagaacgacacagaggaaagggccaag
atcgagagcgccttgacctccctacaccagcggatcagcgagctggagaaaggtcagaaa
gacaatcgacccggagacaagtttcagctgacattcccactgcggaccaactacatgtat
gccaaggtgaagaagagcctgccggagatgtacgccttcactgtgtgcatgtggctcaag
tccagcgcggcacctggagtgggcacgcccttctcctatgctgtacctgggcaggccaac
gagctggtcctcatcgagtggggcaacaaccccatggagatactcattaacgacaaggtg
gccaagctgccctttgtaatcaacgacggcaagtggcaccacatatgcgttacctggacc
acccgggacggggtctgggaggcctatcaggatggcacccagggaggcaatggagagaac
ctggcaccctatcaccctatcaaaccacagggtgtgctggtgctaggccaggagcaggac
actctaggcggagggtttgatgccacccaagcgtttgtgggtgagctagcccatttcaac
atctgggaccgcaagctgacccctggggaggtgtacaacttggccacctgcagcagcaag
gccctctctggcaatgtcatcgcctgggctgagtcccagatcgagatctttggaggagcc
accaagtggacattcgaggcttgccgccagatcaactga

DBGET integrated database retrieval system