KEGG   Rattus norvegicus (rat): 266792
Entry
266792            CDS       T01003                                 

Gene name
Zscan26, Azf8, Zfp187, Znf187
Definition
(RefSeq) zinc finger and SCAN domain containing 26
  KO
K09230  SCAN domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    266792 (Zscan26)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    266792 (Zscan26)
SSDB
Motif
Pfam: SCAN zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 XPA_N Zn-ribbon_8 zf-C2H2_jaz zf_UBZ zinc_ribbon_15 zf-C2H2_3rep DUF5830 zf-C2H2_11 FYVE
Other DBs
NCBI-GeneID: 266792
NCBI-ProteinID: XP_017443218
RGD: 727885
Ensembl: ENSRNOG00000053518
Vega: OTTRNOG00000001782
UniProt: D3ZFY2
Position
17p11
AA seq 465 aa
MALALIHPNKRAYSLAPLNLKEELQGFKVQGDRKGVGQEPLCKQFRQLRYEESTGPREVL
RRLRELCRQWLRPETHSKEQILELLVLEQFLTILPRDLQVQVLEHHPETGEDLVGILEDL
QLDRGKAGEQKDSAQRTRPTVLVGEPAPHREAQEQPGFVVLKPEERGKETRSENGKFTGG
IDSCGRVESSCTMSEPIEAQCEDLSLKKYPAMPKGKTNSQCLETKERLVQNSGLIERDRT
HTGERSCESVVYQSSVATEHQEISKEKGHPCQECGKVFQRSSHLIRHQKIHLGEKPYQCK
ECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQKIHSQDEPRECKECGK
TFSRALLLTHHQRVHGRSKRHHCNECGKAFSLTSDLIRHHRIHTGEKPFKCNVCQKAFRL
NSHLDQHVRIHNEEKLYKCSECNEAFRQKSGLFQHQRHHHKSKLA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcactggccttgatccaccctaacaagcgtgcatactctttggctcccctgaatctg
aaggaggagcttcagggattcaaagttcaaggggacagaaaaggcgttgggcaggagcca
ttgtgcaaacagttcaggcagctgcgctatgaggaaagcactggacctcgagaggtttta
cgccgactcagggagctctgcagacagtggctgcggcctgagacccacagcaaggagcag
atcctggagctgctggtactggagcagttcttgaccatcctgccaagagatctgcaggtc
caggtgctcgagcaccacccagagactggggaggacctggtgggaatactggaagatttg
cagctggatcgtggaaaagcgggagagcagaaggactcagcccaaagaaccagaccgact
gtgctggttggagagccagcccctcatagagaagcacaggagcaaccggggtttgtggtt
ctgaagcctgaggagagaggtaaagagacaaggagtgagaatgggaagttcactggaggg
atagactcttgtggaagagtggaatcatcctgtacaatgtctgaacccatcgaggcccag
tgtgaggacctgagcttgaaaaagtatccagccatgcccaaaggaaaaactaacagtcaa
tgcttagaaactaaggagagacttgttcagaactcaggcctgattgaacgtgacagaacg
catacaggagaaaggtcctgtgaatctgtagtgtatcagagttctgttgctactgaacat
caggaaatctctaaagagaaaggtcacccctgccaagagtgtgggaaagtctttcagaga
agttcacacctcatcagacatcagaaaatccatcttggtgagaagccttaccagtgcaaa
gagtgtggaaaagtctttagccagaatgcaggtcttttggagcatctcaggatccatact
ggagaaaaaccctatctgtgtatccattgtggaaagaacttcaggcgaagctctcatctt
aatagacatcaaaaaattcacagtcaggatgagccccgagaatgcaaggagtgtgggaaa
acctttagtcgggccctcctcctcacccaccatcagagagtccatggtcgttccaaaaga
catcattgtaatgagtgtgggaaagccttcagtttgacctctgaccttattcgacatcac
aggattcacactggagaaaaacctttcaaatgtaatgtgtgtcagaaagctttccgtcta
aattcacacctagatcagcacgtcagaatccacaatgaagaaaaactctacaagtgtagt
gaatgcaatgaagccttcaggcagaagtctggtctctttcagcatcagcgacatcaccat
aaaagtaaactggcttga

DBGET integrated database retrieval system