KEGG   Rattus norvegicus (rat): 266802
Entry
266802            CDS       T01003                                 

Gene name
Alk
Definition
(RefSeq) ALK tyrosine kinase receptor precursor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05223  Non-small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    266802 (Alk)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    266802 (Alk)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    266802 (Alk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    266802 (Alk)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    266802 (Alk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     266802 (Alk)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   266802 (Alk)
CD molecules [BR:rno04090]
 Proteins
  266802 (Alk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich FXa_inhibition
Other DBs
NCBI-GeneID: 266802
NCBI-ProteinID: NP_001162572
RGD: 628622
Ensembl: ENSRNOG00000008683
Position
6
AA seq 1617 aa
MGALGFLWLLPPLLLTAASYSGAATDQRAGSPASGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPQPPSPSEPGAGGLEARGSLALDCDPLLRLLGPSPGISWAEGASSPS
PEAAPTLSRVLKGGSVRKLRRAKQLVLELGEETILEGCIGPPEEAAAVGILQFNLSELFS
WWILHGEGRLRIRLMPEKKASEVGREGRLSTAIRASQPRLLFQIFGTGHSSLESPSEMPS
PPGNFLWNLTWTMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHTHGNQSWSWRRVPSE
EASRMNLLDGPEAEHLKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQ
PSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLHGRVGRPENPFRVALEYISSGNRSLSA
VDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQNCAQGEDEGQLCSKLPA
GFYCNFEDGFCGWTQSPLSPRVPRWQVKTLKDTHSQGHQGHALLLSTTDDPTSESATVTS
ATFPAPMKSSPCELRMSWLIRGVLKGNVSLVLVENKTGKEQSRTVWHVATNEGLSLWQWT
VLSLLDVTDRFWLQIVTWWGPGSRATVAFDNISISLDCYLTISGEEKMSLNAVPKSRNLF
EKNPNKEPKPWANISGPTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVVVGS
EGPLRGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDTLYILVG
QQGEDACPRANQLIQKVCVGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPV
PLIIAAGGGGRAYGAKTETFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSL
LEGAAGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGV
SFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAD
DGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSP
EYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVS
GMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILL
ELMAGGDLKSFLRETRPRPNQPTSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCL
LTCPGAGRIAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFG
VLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNF
AIILERIEYCTQDPDVINTALPIEYGPVVEEEEKVPMRPKDPEGMPPLLVSPQSAKHEEA
SSAPQPSALAAPGPLVKKPSGAGAGAGAGPVPRGAADRGHVNMAFSQPNPPPELHKGPGS
RNKPTSLWNPTYGSWFTEKPAKKTHPPPGAEPQARAGAAEGGWTGPGAGPRRAEAALLLE
PSALSATMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAPGDTVLKSKTKVTQPGP
NT seq 4854 nt   +upstreamnt  +downstreamnt
atgggagcccttgggttcctgtggctgctgccgccgctgcttttgacagcagcctcgtac
tccggagctgcaaccgatcagcgcgcgggttctccagcctcagggccgcctctgcagccc
cgggagccgctcagctattcgcgcctgcagaggaagagtctggcggtggacttcgtggtg
ccctcactcttccgcgtctatgcccgagacctgctgctgccgcagccaccgtccccctcg
gagcccggggctggcgggctggaggcgcggggatcactggctctggactgcgaccctctg
ctcaggttgctggggccatcgcctggaatctcctgggcagagggagccagttctcctagt
ccggaggcggctccgacgctgtccagggtgctgaagggcggctcggtgcgcaagctcagg
cgtgccaaacagctggtgctggagctgggcgaggagacgatccttgaaggctgcattggt
cccccagaggaggcggcggctgtggggatactccagttcaaccttagcgagctgttcagc
tggtggattctacacggcgaagggcggctgaggatccgcctgatgcctgagaagaaggca
tcggaagtgggcagggagggaaggctatccactgcgatccgagcctcccagccccgcctt
ctcttccagatcttcgggaccggtcacagctccttggaatcaccctcagaaatgccttct
cctcctggtaactttctatggaatctcacctggacaatgaaagactccttccctttcctt
tcccaccgcagtcgatatggtctggagtgcagcttcgattttccctgtgagctagaatac
tcccctcccctccacacccatgggaaccagagctggtcctggcgccgtgtgccctctgag
gaggcctcgaggatgaacttgttggatgggccagaggcagagcatttgaaagagatgccc
agaggctccttcctcctcctgaacacctctgcagattccaagcataccatcctgagcccc
tggatgaggagcagtagtgagcactgcacgctggctgtctcagtgcacagacatctacag
ccttctgggagatatgttgcccagctcctaccccacaatgaagctggaagagagattctt
ctggtgcctaccccggggaaacatggctggacagtgctgcatgggagagtcgggcgccca
gagaacccattccgagtggccctggaatacatctcgagtggaaaccggagcttgtctgcg
gtggatttctttgccctgaagaactgcagtgaaggaacatccccaggctccaagatggcc
ttgcagagttccttcacttgttggaacgggacagtcctccagctcgggcaagcctgtgac
ttccaccagaactgtgcccaaggagaagatgagggtcagctatgcagtaaacttcctgct
gggttttactgtaacttcgaggatggcttctgtggctggacccaaagtccactctcaccc
cgtgtgccccgatggcaagtgaagaccctgaaagatacccattcccagggccaccaaggc
catgccctgttgctcagcaccactgacgaccccacttcagaaagtgcaacagtgaccagt
gctacattccccgcaccaatgaagagctctccttgtgagctccggatgtcctggctcatc
cgtggggttctgaaaggaaatgtatctttggtgctggtggagaacaaaactggaaaggag
caaagccggaccgtctggcatgttgccaccaatgaaggcctaagcctgtggcagtggaca
gtgttgtcgctcctcgatgtgactgacaggttctggctgcaaatagtcacatggtggggc
ccaggatccagggcaaccgtggcatttgacaacatttccatcagcctcgactgctacctc
accatcagtggggaggagaaaatgtccctgaatgcagtacccaaatccagaaatctgttt
gagaaaaacccaaacaaggagccaaaaccctgggcaaacatatcaggaccaactcccatc
ttcgaccctacagttcactggctgttcaccacatgtggggccagtggccctcatggcccc
acacaggcacagtgcaacaacgcctaccagaactccaacctgagcgtggtggtgggaagt
gaagggcccttgaggggcatccagatttggaaagtgccagctactgacacctacagtatc
tcaggctatggagcagctggcggaaaaggtgggaagaacaccatgatgcggtcccatggc
gtgtctgtcctgggcatcttcaatctggagaaagatgacacgctctacatccttgtcggt
caacaaggggaagatgcctgtcccagggcaaaccaactaatccagaaagtatgtgtcggc
gagaacaatgtgatagaagaagagatccgagtgaacagaagcgttcacgagtgggcagga
ggaggaggaggtgggggtggagccacctacgtgtttaagatgaaagacggcgtgcccgtg
cccctgattattgcggccggcggtggtggcagggcctatggggccaagacagaaacgttc
cacccagagagactggagaataactcctcagttctagggctgaacggcaattccggagcc
gcaggtggtggaggcggctggaatgataacacttccttgctctgggccggaaagtctttg
ttggagggcgccgccggaggacattcctgcccccaggccatgaagaagtgggggtgggag
acaagagggggtttcggagggggtggaggggggtgctcctcaggtggaggaggcggagga
tatataggtggcaacgcagcatcaaacaatgaccccgaaatggatggggaagatggggtt
tccttcatcagtccattgggtatcctgtataccccggccttaaaagtgatggagggccat
ggggaagtgaatatcaagcactatctaaactgcagccactgtgaggtagacgaatgtcac
atggaccccgagagccacaaagtcatctgcttctgtgaccatgggaccgtgctggctgac
gatggtgtctcctgcattgtgtcgcccaccccggaaccccacctgccgctctcattgatc
ctctccgtcgtgacctctgccctggtggccgctctcgttctggcattctccggcatcatg
attgtgtaccgccggaagcaccaggagttgcaagctatgcagatggagctgcagagccct
gagtataagctgagcaagctacggacctcgaccatcatgacagactacaaccccaactac
tgctttgctggcaagacttcatccatcagtgacctgaaggaggtgcctcggaaaaacatc
accctcatccggggcctaggccatggcgcatttggggaggtgtatgaaggccaggtatct
ggaatgcccaatgacccaagccctctacaagtggctgtaaagacgctgccggaagtgtgt
tcagagcaagatgagctggacttcctcatggaagctctgatcatcagtaaattcaaccac
cagaacattgtccgctgcatcggggtgagtctgcaagccctgccccgcttcatcctgctg
gagctcatggctggtggagacctcaagtccttcctcagggagacacgtcctcgcccgaac
cagcccacctccctggccatgttggatcttctgcacgtagctcgggacattgcctgtggc
tgtcagtacctggaggaaaatcactttatccaccgcgatattgctgctagaaactgtctg
ctgacctgtccgggagctgggaggatagcgaagatcggagacttcgggatggcccgagat
atctacagggccagctactacagaaagggaggctgtgccatgctgccagtgaagtggatg
cccccggaggccttcatggaaggaatatttacttctaaaacagatacatggtcttttgga
gtgttgctgtgggaaatattttctcttggatatatgccataccccagcaagagcaaccag
gaagttctggagtttgtcaccagtggaggacggatggacccacctaagaactgccccgga
cctgtataccggataatgactcagtgctggcagcatcagcctgaggacagacccaacttt
gccatcattctggagaggatcgaatactgcacccaggaccccgatgtcatcaatacagct
ctgcccatcgaatatggccccgtagtagaggaggaggagaaagtgcccatgcgccccaaa
gaccctgaggggatgcctcctctgctggtgtctccccagtctgcgaagcacgaggaggcg
tcctcagccccccaaccctcagccctggcagcgccaggcccgctggtgaagaagccctcg
ggtgcaggcgcgggagcgggtgccggtccggtgccccgaggtgcagccgatcggggccac
gtgaacatggcgttctctcagcccaaccctcccccagagctgcacaaaggcccgggctcc
agaaacaagccgaccagcctgtggaaccccacctacggctcgtggttcaccgagaagcca
gccaaaaagacccatcccccaccgggcgcggagccgcaggcccgggcaggagcggcggag
ggtggctggaccgggccgggtgcggggccccgcagagccgaggctgcgctgctgctcgag
ccgtcggcgctcagcgccaccatgaaggaggtgcccctgttcaggctgcgccacttcccc
tgcggcaacgtcaactatggttaccagcaacagggtctccccttggaagccactgctgcc
ccgggggacaccgtgctgaaaagcaagactaaggtcacccagccagggccctga

KEGG   Rattus norvegicus (rat): 313861
Entry
313861            CDS       T01003                                 

Gene name
Eml4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05223  Non-small cell lung cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    313861 (Eml4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    313861 (Eml4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    313861 (Eml4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    313861 (Eml4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     313861 (Eml4)
SSDB
Motif
Pfam: WD40 HELP ANAPC4_WD40 TolA
Other DBs
NCBI-GeneID: 313861
NCBI-ProteinID: NP_001101478
RGD: 1304690
Ensembl: ENSRNOG00000030294
UniProt: F1LT71
Position
6
AA seq 854 aa
MPSKGQPSLREAISMSCITNGSGINRKQNHTSSISIARKETLSSAAKSIKRPPTAEKSHN
SWENSDDSRNKLLKTVSTSKLISKVIKNTDKHKDVIINQAKMSTREKSSQEGEYIKMFMR
GRPITMFIPSDVDNYDDIRTELPPEKLKLEYGYRGKDCRANVYLLPTGEIVYFIASVVVL
FNYEERTQRHYLGHTDCVKCLAVHPDKIRMATGQIAGVDKDGRPLQPHVRVWDSVSLSTL
HVIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQRKSKVAEIKTTNEVVLA
VEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGD
SGGVMLIWSKTTIEPPPGKGPKGVYQISRQIKAHDGSVFTLCQMRNGMLLTGGGKDRKII
LWDHDLNLEREIEVPDQYGTIRAVAEGKAEQFLVGTSRNFILRGTFNDGFQIEVQGHTDE
LWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHS
GRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHDNFIYLYAVSENGRKYSRY
GKCTGHSSYITHLDWSPDNKHIMSNSGDYEILYWDIENGCKLIRNRSDCKDIDWTTYTCV
LGFQVFGVWPEGSDGTDINALVRSHHRRVIAVADDFCKVHLFQYPCSKPKAPSHKYSAHS
SHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLPLPQNEVIADTSSTKAPASATENARL
CNAPQPPSQPLPGTAEEESRVSSSPTLVENSLEQSEWGSEDLGVVIDEEPASERGEKQGA
AEASEEEQGAAPLC
NT seq 2565 nt   +upstreamnt  +downstreamnt
atgccaagtaaaggccaaccaagtcttcgagaagctatttctatgtcctgtataaccaat
ggaagtggtataaacagaaaacagaaccataccagctctatatcgatagcaagaaaagaa
actctttcttcagctgctaaaagcataaaacgtccaccaacagctgaaaagtcacataac
tcatgggaaaattcagatgatagtcgtaataaattattgaaaacggtttcaacatcaaaa
ctaatatcaaaggttataaaaaatacagacaaacataaagatgtcatcatcaatcaagca
aaaatgtcaacccgggagaaaagcagccaagaaggagaatatattaaaatgtttatgcga
ggtcggccaattacaatgttcattccttcggatgttgacaactatgatgacatcagaaca
gaactgcctcctgagaagctcaaactggaatatggttatcgaggaaaggactgtcgagca
aatgtttacctgcttcccacaggggagatagtttatttcatcgcttcagtagtggtcctg
tttaattatgaggagaggactcagcgacactacctgggtcatacagactgtgtgaaatgc
ctcgctgtacatcctgacaagattaggatggcaactggacagatagccggagtggacaag
gacggaaggcctctgcaaccccatgtcagggtgtgggattcagtaagtctttccacgctg
catgttattggacttggaactttcgagcgtggagtaggatgcctggatttttcaaaagca
gactcaggtgttcacttatgcgttattgatgactccaatgaacacatgcttactgtgtgg
gactggcagagaaagtccaaagtagcagaaataaagacaacaaacgaagttgttctggct
gtggaattccacccaacagatgcaaatacaataataacatgtggtaaatctcatattttt
ttctggacctggagtggcaattcgctaacaagaaaacagggaatttttgggaaatatgaa
aaaccaaaattcgttcagtgtttggcattcttggggaatggagatgttctcactggagac
tcaggaggagtcatgcttatctggagcaaaactaccattgagcccccgcccgggaaagga
cctaaaggtgtatatcagatcagcagacagatcaaagctcatgacggcagtgtgtttacg
ctttgtcagatgagaaatgggatgctattaactggaggcgggaaagacagaaaaataatt
ttgtgggatcatgacctgaaccttgagagagaaattgaggttcctgatcagtacggcacg
attcgagcagttgcagaaggaaaggcagaacagtttttagtgggcacatcacgcaacttt
attctacggggaacatttaatgatggcttccaaatagaagttcagggtcatacagatgaa
ctctggggccttgcaacacatcctttcaaagatttgcttttgacgtgtgctcaggacagg
caggtgtgcatgtggaactcagtggagcacaggctggagtggaccaggcttgtggacgaa
ccaggacactgtgcagactttcatccaagcggtacagtggtggccatcggaacacactca
ggcaggtggtttgttctggatgcagaaacaagagatctggtatcaatccacacagatggg
aatgagcagctctcggtgatgcgctactcagtggatggtactcttctggctgtgggatct
catgacaactttatttacctctatgcagtctcagaaaatggaagaaaatacagcagatat
ggaaagtgcactggacattctagctacatcacacaccttgactggtctccagacaataag
catataatgtctaactcgggtgactacgagatactgtactgggacattgaaaatggctgc
aaactaatcaggaaccgatcagattgtaaggacatcgattggacaacatacacctgtgtg
ctaggcttccaagtctttggtgtctggccagaaggatccgatggaacagacatcaacgcc
ctggttcgatcccaccatcgaagggtgatagccgtggccgatgatttctgtaaagttcat
ctgtttcagtatccctgctccaaaccaaaggcccctagtcacaagtacagtgcccacagc
agccacgtgaccaacgtcagttttactcacaatgacagtcacctcatttcaaccggtggg
aaggatatgagtatcattcagtggaagctggtggaaaagttacctttgcctcaaaatgag
gtcatagcagacaccagttcaaccaaagcccctgcctctgccactgaaaacgccaggctg
tgtaacgctccacagcctccttcccagccgttacctgggacggcagaagaagaaagcaga
gtaagcagctcccccacgctcgtggagaacagtctggagcagagcgagtggggcagcgaa
gaccttggtgtggtgattgatgaagagccagctagtgagcgaggggagaagcagggagca
gccgaggcgtctgaggaggagcaaggcgcggctcccctgtgctaa

DBGET integrated database retrieval system