KEGG   Rattus norvegicus (rat): 266813
Entry
266813            CDS       T01003                                 

Gene name
Prrx1, Pmx1, Prx-1
Definition
(RefSeq) paired related homeobox 1
  KO
K09329  paired mesoderm homeobox protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    266813 (Prrx1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    266813 (Prrx1)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 266813
NCBI-ProteinID: NP_722543
RGD: 628884
Ensembl: ENSRNOG00000003720
UniProt: P63014
Position
13q22
AA seq 245 aa
MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADESVGEA
GRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD
AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIV
PRPAPRPTDYLSWGTASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQ
VPTVN
NT seq 738 nt   +upstreamnt  +downstreamnt
atgacctccagctacgggcacgttctggagcggcaaccggctctgggcggccgcttggat
agccctggcaacctcgacaccctgcaggcgaaaaagaacttctccgtcagtcacctgcta
gacctggaggaggccggggacatggtggcggcacaggcggacgaaagcgtgggcgaggcg
ggccggagcctgctggagtcaccgggactgaccagtggcagcgacacccctcagcaggac
aatgatcagctgaactctgaggagaagaagaagagaaagcaacggagaaacaggacaacc
ttcaatagcagccagctgcaggccttggagcgtgtcttcgagaggacccattacccggat
gcttttgtacgggaagatcttgcacgtcgggtgaacctcacggaggccagagtgcaggtg
tggtttcagaaccgaagagccaagttccgcaggaatgagcgagccatgctggccaataaa
aacgcttctctcctcaagtcctactcaggagacgtgactgccgtggaacaacccattgta
cctcgtcctgctcccagacccaccgattatctctcctgggggacagcctctccgtacagc
gccatggctacttattctgccacatgtgccaacaatagccctgcgcagggtatcaacatg
gccaacagcattgccaacctgagactgaaggccaaggaatatagtttacagaggaaccag
gtgccaacagtcaactga

DBGET integrated database retrieval system