KEGG   Rattus norvegicus (rat): 26760Help
Entry
26760             CDS       T01003                                 

Gene name
Akr7a3, Afar, Akr7a1
Definition
(RefSeq) aldo-keto reductase family 7 member A3
  KO
K15303  aflatoxin B1 aldehyde reductase
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00980  Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    26760 (Akr7a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 26760
NCBI-ProteinID: NP_037347
RGD: 628635
Ensembl: ENSRNOG00000017899
UniProt: P38918
Structure
PDB: 

Position
5q36
AA seq 327 aa AA seqDB search
MSQARPATVLGAMEMGRRMDVTSSSASVRAFLQRGHTEIDTAFVYANGQSETILGDLGLG
LGRSGCKVKIATKAAPMFGKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDHGTPIEET
LQACHQLHQEGKFVELGLSNYVSWEVAEICTLCKKNGWIMPTVYQGMYNAITRQVETELF
PCLRHFGLRFYAFNPLAGGLLTGRYKYQDKDGKNPESRFFGNPFSQLYMDRYWKEEHFNG
IALVEKALKTTYGPTAPSMISAAVRWMYHHSQLKGTQGDAVILGMSSLEQLEQNLALVEE
GPLEPAVVDAFDQAWNLVAHECPNYFR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagcccggcctgccactgtgctgggtgccatggagatgggtcgccgcatggat
gtgacctccagctccgcgtcggtgcgcgccttcctgcagcgcggccacacggagatagac
accgccttcgtgtatgcgaacggtcagtctgagaccatcctaggagacctggggctcgga
ctgggccgcagcggctgcaaagtaaaaattgccaccaaggctgccccaatgtttgggaag
acactgaagccagccgatgttcggttccagctggagacgtcactgaagaggctgcagtgt
ccccgggtggacctcttctatttacactttccagaccacggcactcctatagaggagacc
ctgcaggcctgccaccagctgcatcaggagggcaagtttgtggagcttggtctgtccaac
tatgtctcctgggaagtggctgagatttgtaccctctgcaagaaaaatggctggatcatg
ccaactgtgtaccagggcatgtacaacgccatcaccaggcaggtggagactgagctcttc
ccctgcctcagacacttcggactaaggttctacgccttcaaccctttggctgggggcctg
ctgactggcagatataaataccaggataaggatgggaagaatcctgagagccgcttcttt
gggaatccattttctcaactgtacatggaccgctactggaaggaggaacacttcaatggc
atcgccttggtggagaaggctctgaagactacctatggccccactgcccccagtatgatc
tcagctgccgtacggtggatgtaccatcactcacagctcaagggcacccaaggggatgca
gtcattctgggcatgtccagtctggaacaactggagcagaacttggccttggtcgaggaa
gggcctctggagccagctgttgtggatgcctttgaccaagcctggaacctagttgcccac
gagtgtcccaactatttccgctaa

DBGET integrated database retrieval system