KEGG   Rattus norvegicus (rat): 26955
Entry
26955             CDS       T01003                                 

Gene name
Afdn
Definition
(RefSeq) afadin
  KO
K05702  afadin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04520  Adherens junction
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    26955 (Afdn)
   04015 Rap1 signaling pathway
    26955 (Afdn)
   04024 cAMP signaling pathway
    26955 (Afdn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    26955 (Afdn)
   04530 Tight junction
    26955 (Afdn)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    26955 (Afdn)
SSDB
Motif
Pfam: RA DIL PDZ FHA PDZ_6 PDZ_2 Yop-YscD_cpl
Other DBs
NCBI-GeneID: 26955
NCBI-ProteinID: NP_037349
RGD: 708561
Ensembl: ENSRNOG00000023753
UniProt: O35889
Position
1
AA seq 1829 aa
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKD
DREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQA
SDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSS
DGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAESLEKYGLEKENPKDYCIARV
MLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVE
GKPLKGKDRADGSGYGSALPPEKLPYLVELSPGRRNHFAYYSYHTYEDGSDSRDKPKLYR
LQLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVDGQRISET
TMLQSGMRLQFGTSHVFKFVDPIQDHVLSKRSVDGGLMVKGPRHKPGAVQETTFELGGDI
HSGTALPASRSTTRLDSDRVSSASSTAERGMVKPMIRLDQEQDYRRRESRTQDAAGPELM
LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQHRPDISPTERT
HKAIAVVNKMVSMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITL
DAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLL
RRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQ
GLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPF
IPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQ
EFLDPLCQRGFCRLVPHTRSPGTWTIYFEGADYESHLMRENTELTQPLRKEPEVITVTLK
KQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQER
AAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYN
NSAQNGSPESPQMPWTEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSPYTSGT
AAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPVQNQWPNYE
EKPHMHTESDHASIAIQRVTRSQEELREEKVYQLERHRVESGMDRKCDSDMWINQSSSVE
SSTSSQEHLNHSSKSVTPASTLTKSGPGRWKTPAAVLPTPVAVSQPIRTDLPPPPPPPPA
HYTSDFDGISMDLPLPPPPANQAAPQSAQVAAAERKKREEHQRWYEKEKARLEEERERKR
REQERKLGQMRTQSLNPASFSPLATQAKPEKPSTLQRPQETVIRELQPQQQPRTIERRDL
QYITISKEELSSGDSLSPDPWKRDAREKLEKQQQMHIVDMLSKEIHELQNKGDRTAEESD
RLRKLMLEWQFQKRLQESKQKDEDDDEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQ
LEEMRKREVEDRVRQEEDGRHQEEERVKRDAEEKRRQEEGYYSRLEAERRRQHEEAARRL
LEPEEPGLSRPPLPQDYEPPSQSSAPSAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYDD
DDEEENYVPAGPNSYSGSAGTTAGTYDAPRDTREKLSRSQDADLPGSSGAPENLTFRERQ
RLFSQGQDVSDKVKASRKLTELENELNTK
NT seq 5490 nt   +upstreamnt  +downstreamnt
atgtcggcgggcggccgcgacgaagagcggcggaagctggccgacatcattcaccactgg
aacgccaaccggctggacctgttcgagatcagccagccgaccgaggatttggagtttcat
ggagtcatgagattttattttcaagataaagctgctggaaactttgcaacaaaatgtatt
cgggtctctagcacagcaaccactcaagatgtcattgaaacactggcagagaagttccgc
cctgatatgcgcatgctctcctctcccaagtactccctctatgaagtgcatgtcagtgga
gaaagaagattggacattgatgagaaacctctagttgtacagttgaattggaacaaagat
gatcgggagggtagattcgtccttaagaacgagaatgacgccattcctgccaagaaggct
cagagtaatggacctgagaagcaggagaaagaaggtgttattcagaacttcaaaagaact
ctgtcaaagaaagaaaagaaggaaaaaaagaagagagagaaggaggctttgagacaagcc
tctgataaggaagaaaggccttctcaaggggatgacagtgagaattctcgtctggctgct
gaagtttacaaagacatgcctgaaaccagctttactcgaacgatttctaatcctgaagtt
gttatgaaacggcggcggcagcaaaaactggagaagagaatgcaagagtttcggagctca
gatgggcggcccgactcgggtggaacactgagaatctatgcagacagtttaaaaccaaat
attccatacaagacaatcctgctgtctactacagatcctgcagactttgctgtagcagag
tccttagagaagtatggtctggaaaaagagaaccccaaggactactgcattgctcgggtt
atgcttcctcctggagcccagcattctgatgagagaggtgctaaggaaataattcttgat
gacgatgaatgccctttacaaatcttcagggaatggccaagtgacaaagggattttagtc
tttcagttgaagaggagaccaccggactacattccaaagaaaatgaagaaacatgttgaa
ggcaagccattgaaggggaaagatagagctgacgggtctggctacggctctgctcttcct
cctgagaagctgccctacttagtagagctcagcccagggagaaggaatcactttgcctac
tacagctatcacacttacgaagatggctctgactccagagacaagccaaagttataccgc
cttcagttaagtgtgactgaagttgggacagagaagttcgatgacaattctattcagctg
tttggtcctggaattcagccccatcactgtgatctcaccaacatggatggagtggtcact
gtgacacccagaagtatggatgcagagacctatgtggatggtcagcgcatctcagagacc
acaatgctacagagtggcatgagactgcagtttggcacctcgcatgtgtttaagtttgtg
gaccccatccaggaccacgttctttccaagagatctgtggatggaggcctgatggtcaag
ggcccaagacataaacctggagccgttcaagagacaacctttgaattgggaggagatatc
cacagtgggacagcattgccggcaagcaggagcactactagattggacagtgacagggtg
tcctctgcctctagcacagctgagcgagggatggtgaagccaatgatccgactggaccag
gagcaggactaccggcgaagagaaagcaggactcaggatgctgctgggcctgaactgatg
ctgcctgccagcattgaattccgggaaagctctgaagactcttttttatctgccattata
aactataccaatagctctacagttcattttaagttgtcacctacatatgtgttatacatg
gcatgccggtatgtattgtccagccagcacaggcccgacatcagtcctacagagcggaca
cataaggccattgctgttgtgaacaagatggtgagcatgatggaaggggtcatccaggaa
gtagaccaggttgatcagaaacagaagaacattgcaggagcacttgctttctggatggca
aatgcatctgagcttctcaacttcatcaagcaggaccgagaccttagtcggattactctg
gatgcccaggatgttctagcacacttggttcagatggcatttaagtacttggttcactgc
cttcagtcagaacttaataactacatgccagcctttctggatgatcccgaggagaacagt
ctgcagagaccaaaaatagatgatgtgctgcatacgctcacaggagccatgtccttgttg
cggcgctgcagagtcaatgccgccttgaccatccagctgttctctcagcttttccacttc
atcaatatgtggctattcaacagactggtgactgacccagattcaggcctgtgttcccac
tactggggcgcaattatccgccagcagctggggcatattgaagcttgggcagagaagcag
ggactagagttggcagctgactgtcacttgagcaggatcgtgcaggctactacgttgctt
acaatggataagtatgtacctgatgacattccaaatataaacagcacatgctttaagtta
aattctctgcagcttcaagccctcttacagaattaccactgtgcacctgatgagcctttt
attcctacggatctcatagaaaatgtcgtggctgttgctgagaacacagctgatgagctt
gcccgcagtgatggcagagatgtgcagttagaggaggaccctgatctacaactgcccttt
cttctgccagaagatggctattcctgtgatgttgtcagaaacattccaaatggtttacaa
gaatttttagaccctctgtgccagagaggattttgcaggttggttcctcacacacgttct
ccaggtacctggacaatatattttgaaggagcagattatgaaagtcacctcatgcgtgag
aacacagaactgacccagcctctgaggaaggagcctgaggtaatcactgtgaccctgaag
aagcagaatggaatgggcctcagcattgttgcagcaaagggtgctggccaggataaactg
ggaatctacgttaagtccgttgtcaaaggaggtgctgcagatgtggatggacgcctagct
gctggtgaccaactccttagtgtggatggacgaagtctggttggactttctcaggaaagg
gcagcagaactcatgacaagaaccagttccgtggtaacactggaagttgcaaagcaaggc
gctatctatcacggactggccactctccttaaccagccatcacccatgatgcagagaatt
tcagatcgtcgtggctcaggtaaacccagaccaaagagcgaaggttttgagctctataat
aattcagctcaaaacggctccccagagagtcctcagatgccttggacagagtacagtgag
ccaaagaagctgcctggtgacgacaggctgatgaaaaacagagctgaccaccgttccagc
cccaatgtggcaaatcagccccctagtcctggagggaagagtccatatacctctggaaca
gcagctaaaataacatctgtctctactggaaacctctgcactgaggagcagacccctcca
cctagacctgaagcctatcctatccctactcagacatataccagagagtattttaccttt
ccagcttcaaagtcgcaggatcggatggctcctgttcaaaaccagtggccaaattatgag
gaaaaaccacacatgcacacagaaagtgatcatgccagtattgcaatccagcgtgttacc
cgttcccaggaagagcttcgggaagagaaggtttaccaacttgagcgtcatcgagtagag
tcaggcatggatcgcaagtgtgacagtgatatgtggatcaatcagagctcctcagtggaa
tctagcacgtctagccaggagcacctgaaccattcctccaagtcagttacccctgcttcc
actctgaccaagagtggtcctggtcgttggaaaaccccagcagctgtgctccccacccct
gtggctgtctcccaacccattcgaacagacctccctccaccaccacctccaccacctgcc
cactacaccagtgattttgatggtatttcaatggatttgcccctcccacctcctcctgcc
aaccaagcagctccccagtctgctcaggtggctgctgcagagaggaaaaagagagaggag
catcagaggtggtatgaaaaagagaaggcccgcctggaggaggaacgagagagaaagcgc
agggagcaagagaggaagttggggcagatgcgcactcagtccctgaaccctgcttccttc
tctcctttggccacacaggccaagccagaaaagccttccacactgcagaggccccaagaa
acggtcattcgggagctgcagccccagcagcagccccgtactattgagcgcagggatctg
cagtacataaccatcagtaaagaggagctgtcctctggggatagtctgtctccagaccca
tggaaacgagatgccagggagaagctggagaagcaacagcaaatgcacattgtagacatg
ctaagcaaggagatccatgagctgcaaaacaagggggaccgtactgcagaggagagtgac
cgcctgcggaagcttatgctggagtggcagttccagaagagactacaggagtccaagcag
aaggatgaggatgatgatgaagaggaagatgatgatgttgacaccatgctgatcatgcag
cgactggaggcggagcggagagccaggttgcaggatgaagagcgcaggcgccagcaacag
ttggaagagatgcggaaacgagaagttgaagacagagtaagacaagaggaagatggacgc
catcaggaggaggagcgagtaaagagagatgctgaagaaaagaggcgacaggaagaaggg
tattacagccgcctagaagctgagaggcgcagacagcatgaagaggcagcacgcaggttg
ctggagcccgaagaacccgggctgagccgacctccacttccacaggactacgagccccca
tcccagtcctcagcacccagtgcccctcctcccccacctcagcgaaatgcctcctacctc
aaaacacaggtcctctccccagactcgctgttcactgccaagtttgttgcgtatgatgat
gatgatgaggaggagaactacgtcccagcaggaccaaactcttattcgggatctgctggc
acaactgctggaacttatgatgctcctcgggacacaagagaaaaactcagtagaagccaa
gatgcagacttacctggcagttctggagcccctgaaaacctgacatttagagagcgtcag
cgcctcttttcacaaggtcaagatgtgtcagacaaagtgaaagcttctcgtaaattaaca
gagcttgagaatgaactcaacaccaagtga

DBGET integrated database retrieval system