KEGG   Rattus norvegicus (rat): 27137Help
Entry
27137             CDS       T01003                                 

Gene name
Eif2ak1, Hri
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05160  Hepatitis C
rno05162  Measles
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27137 (Eif2ak1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    27137 (Eif2ak1)
   05160 Hepatitis C
    27137 (Eif2ak1)
   05168 Herpes simplex virus 1 infection
    27137 (Eif2ak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    27137 (Eif2ak1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27137 (Eif2ak1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   27137 (Eif2ak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo PKcGMP_CC
Motif
Other DBs
NCBI-GeneID: 27137
NCBI-ProteinID: NP_037355
RGD: 70883
Ensembl: ENSRNOG00000001050
Vega: OTTRNOG00000001900
UniProt: Q63185
Position
12p11
AA seq 620 aa AA seqDB search
MLGGGSVDGERDTDDDAAGAVAAPPAIDFPAEVSDPKYDESDVPAELQVFKEPLQQPTFP
FLVANQLLLVSLLEHLSHVHEPNPLHSKQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHH
NRAITHLMRSAKERVRQDPCQDNSYMQKIRSREIALEAQTSRYLNEFEELAILGKGGYGR
VYKVRNKLDGQHYAIKKILIKSATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVL
QPQDRVPIQLPSLEVLSEHEGDRNQGGVKDNESSSSIIFAELTPEKENPLAESDVKNENN
NLVSYRANLVIRSSSESESSIELQEDGLNESPLRPVVKHQLPLGHSSDVEGNFTSTDESS
EDNLNLLGQTEARYHLMLHIQMQLCELSLWDWIAERNKRSRKCVDEAACPYVMASVATKI
FQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACADIIQKSADWTNRNGK
GTPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSLGVILLELFQPFGTEMERATVLTGVRT
GRIPESLSKRCPVQAKYIQLLTGRNAAQRPSALQLLQSELFQTTGNVNLTLQMKIMEQEK
EIEELKKQLSLLSQDKGLKR
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgctggggggcggctccgtggatggcgagcgcgacacggacgacgacgcggcgggggcg
gtggccgcgcctcctgccatcgacttccccgcagaggtgtcggaccccaagtatgatgag
tccgatgtcccagcagagctccaagtgttcaaagagcccttgcagcagcccacgttccct
ttcttagtggcaaaccagctgctgctggtctccttgctggaacacttgagccatgtgcac
gagccgaacccacttcactcaaaacaggtctttaaattactgtgccagacttttatcaag
atggggctgctctcttcctttacctgcagcgatgagttcagctccctgagactccaccac
aacagagccatcactcatttaatgaggtctgccaaggagagagtccgtcaggatccttgt
caagataattcttacatgcagaaaatcagatccagggagatagctctcgaagcacagact
tcacgctacttaaatgaatttgaagagctcgccatcttaggaaaaggcggatatggaaga
gtttacaaggtccggaacaaattagatggtcagcattatgcaattaagaaaatcctgatt
aagagtgcaactaaaacggattgtatgaaggtgctacgggaagtgaaggttctggcaggc
ctccagcaccccaatatcgttggctaccacactgcatggatagagcacgttcacgtgctt
cagccacaagacagagttcccattcaactgccctctcttgaagtgttgtcagagcatgaa
ggggacagaaatcaaggtggtgttaaagataatgaaagcagttcgtccattatctttgct
gaactcaccccagaaaaagaaaaccctttagcggaatctgatgttaagaatgagaataac
aacttggtgagctacagggccaacttagtgatcaggagcagcagtgaaagcgaatcgtcc
attgagctccaagaagatggcttgaacgagtcgcctctcagaccagttgtcaagcaccag
ctgccgctggggcatagctcagacgtggaagggaattttacctccacggatgagtcttct
gaagacaatttgaacctgctggggcagacagaggcgcggtaccacctgatgctgcacatc
cagatgcagctgtgtgagctctccctgtgggactggatagctgagaggaacaagcggagc
cggaagtgcgtggatgaagcagcttgtccctatgttatggccagtgttgcaacaaagatt
tttcaagaactggtggaaggtgtcttttacatacataacatgggcatcgtccacagagat
ctgaagcctagaaatatttttcttcatggtcctgatcaacaagtgaaaataggagacttt
ggtctggcctgtgcagacatcattcagaagagcgcagattggaccaacagaaacgggaaa
ggaacgccgacacacacgtcccgagtggggacttgtctctacgcgtcacctgagcagttg
gaaggatccgagtatgatgccaagtctgatatgtacagcttgggtgtgatcctgctcgag
ctcttccagccattcgggacagaaatggagcgagcaacagtcctaacaggtgtgaggact
ggtcggataccagagtccctcagtaaaaggtgtccagtgcaagccaagtatatccagctc
ctgactgggaggaacgcggcccagagaccatctgctcttcagctactgcagagcgaactg
ttccaaacaacgggaaatgttaatctcacattgcagatgaagataatggagcaagaaaag
gaaattgaagaattaaagaagcaactaagcctcctttcgcaggacaaagggctgaagaga
tga

DBGET integrated database retrieval system