KEGG   Rattus norvegicus (rat): 27150Help
Entry
27150             CDS       T01003                                 

Gene name
Kcnh3, Bec1, Elk2
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 3
  KO
K04906  potassium voltage-gated channel Eag-related subfamily H member 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    27150 (Kcnh3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   27150 (Kcnh3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PAS_9 Ion_trans_2 cNMP_binding PAS_4 PAS_3 PAS UBM S6PP SlyX
Motif
Other DBs
NCBI-GeneID: 27150
NCBI-ProteinID: NP_058804
RGD: 71070
Ensembl: ENSRNOG00000057315
UniProt: O89047
Position
7q36
AA seq 1087 aa AA seqDB search
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISETKNRGGPDNWKERGGGRRRYGRAGSKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYVGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACVWFYIGQQEIENSESELPEIGWLQELARRLETPYYLVSRSPDGG
NSSGQSENCSSSGGGSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDT
EKIFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQR
MLEYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLA
LRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPQREQVVK
ANADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGVSAEVDTSS
LSGDNTLMSTLEEKETDGEQGHTISPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRP
RLGGRGRPSRAGVLKPEAGPSAHPRTLDGLQLPPMPWNVPPDLSPRVVDGIEDGCGSDQH
KFSFRVGQSGPECSSSPSPGTESGLLTVPLVPSEARNTDTLDKLRQAVTELSEQVLQMRE
GLQSLRQAVQLILVPQGEGQCPRVSGEGPCPATASGLLQPLRVDTGASSYCLQPPAGSVL
SGTWPHPRPGHPPPLMAPWPWGPPASQSSPWPRATALWTSTSDSEPPGSGDLCSEPSTPA
SPPPPEEGARTGTPAPVSQAEATSTGEPPPGSGGRALPWDPHSLEMVLIGCHGPGSVQWT
QEEGTGV
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgccggccatgcgggggctccttgcgccgcagaacaccttcctggacaccatcgccacc
cgcttcgacgggacgcacagtaacttcgtcctgggcaacgcccaggtggcagggctcttc
cctgtggtctactgctccgatggcttctgtgacctcacgggtttctccagagctgaggtc
atgcagcgaggctgtgcctgctccttcctctatgggccagacaccagtgagttggtccgc
caacagatccgaaaagccctggatgagcacaaagaattcaaggctgaactgatcctgtac
cggaagagcgggcttccattctggtgtctcctggatgtgatacctataaaaaacgagaag
ggggaggtggccctcttcctggtctctcacaaggacatcagtgagaccaagaaccgagga
ggccctgacaactggaaggagagaggtggtggccgacgcagatatggtcgggcaggatcc
aaaggctttaatgccaatcggaggcgcagccgggcggttctctaccacctctctggtcac
ctgcagaaacaacccaagggcaagcacaaactcaataagggtgtgtttggagagaagcca
aatttgcccgaatataaagtcgctgctatccggaagtcaccctttatcctgctgcactgt
ggggctctgagagccacctgggatggcttcatcctgctcgccacgctctacgtggctgtc
actgtgccatacagcgtgtgtgtgagcacagcacgggagcccagtgctgcccgtggccca
cctagtgtctgtgacctggccgtggaagtcctcttcatcttagatattgtgctgaatttt
cgtactacatttgtgtccaagtcaggccaggtggtattcgccccaaagtccatttgcctc
cactacgtcaccacctggttcctgctggatgtcatagcagcactgccctttgacctacta
catgccttcaaggtcaatgtgtacgttggggctcacctactgaagaccgtgcggctgctt
cggctgctgcgcctactaccaagactggaccggtactctcagtatagcgctgttgtgctc
accttgctcatggctgtgtttgccctgctcgcccactgggtggcctgcgtttggttctac
atcggccagcaagagattgagaacagcgagtcagagctgcctgagatcggctggctgcag
gagctggcacgcaggctggagacgccctattacctggtgagccggagtccagatggaggg
aacagctctggccagagtgaaaactgcagtagcagtggcggcggcagcgaagccaacggg
actgggctggagctgctgggtggcccatccctacgcagcgcctacatcacctccttgtac
ttcgcgctcagcagtctcaccagtgtgggcttcggcaatgtgtccgctaacacagacact
gagaagattttctccatctgcaccatgcttattggagctctgatgcatgcagtggtgttt
gggaatgtgacagccatcatccagcgcatgtacgctcgccgctttctgtaccacagccgc
acccgtgacctgcgagactacattcgcatccaccgcatccccaagcccctcaagcagcgc
atgctcgagtacttccaagccacctgggccgtgaacaacggcatcgataccactgagctg
ctgcagagccttccggatgagcttcgagcagacatcgccatgcacctgcacaaggaggtc
ctgcagctgccattgttcgaggcagcgagccgtggctgcctgcgggcactgtctctggcc
ctgaggcccgccttctgcacgccgggcgagtacctcattcaccaaggcgatgctctccag
gctctctactttgtgtgctcaggttccatggaggtcctcaaaggtggcaccgtcctcgcc
attctagggaagggtgacctgatcggctgtgagctgccccagcgagagcaagtagtgaag
gccaatgccgacgtaaaggggctgacatactgcgtcctacagtgcctgcagctggctggg
ctgcacgagagcctcgcactgtaccctgagtttgccccacgctttagccgtggcctccga
ggggagctcagctacaacctgggagctggaggagtgtctgcagaggtggataccagctca
ctgagtggtgacaacaccctcatgtccacactggaggagaaggagacagatggggagcaa
ggacacacgatctcaccagccccagcagatgagccctccagccccctgctgtcacctggc
tgtacctcctcctcctcagcggccaaactactctccccacgtcgaactgcaccccggccg
aggctgggtggcagagggcggccaagtagggcaggggttttgaagcctgaggctggtcct
tctgctcatccacggacacttgatgggttgcagctgccccccatgccatggaatgtacct
ccagacctgagccccagggtcgtagatggcattgaggatggctgcggctctgaccagcac
aagttctctttccgggtgggtcagtctggcccagaatgtagcagcagcccctccccagga
acagagagtggcctgctcactgtccccttggtgcccagtgaggcaagaaacacagacaca
ctggacaagctacggcaggcggtgacggagctgtctgaacaggtgctgcagatgcgagag
ggactgcagtcacttcgccaggctgtgcagctcatcctggtgccccaaggggaaggccag
tgtccccgggtatcaggagaggggccatgcccagccactgcctctgggctcctacaaccc
ctgcgtgtggacactggggcatcatcctactgcctgcagcccccagcaggttcagtcttg
agtgggacctggcctcacccccgtccagggcatccccctcccctcatggcaccctggccc
tggggccccccagcatctcagagctccccctggcctcgagccacagctttatggacctcc
acctcagactcagagccccctggctctggagacctctgctctgagcccagcaccccagcc
tcaccccctcctcctgaggaaggagctaggactgggactcctgcacctgtgagccaggct
gaggctaccagtactggagagccccctccggggtcagggggccgagccttgccctgggat
ccccacagcctagagatggtgctcatcggctgccatggccctggctcggtccagtggacc
caggaggagggcacaggagtctga

DBGET integrated database retrieval system