KEGG   Rattus norvegicus (rat): 282547Help
Entry
282547            CDS       T01003                                 

Gene name
Mrgprx1, Mgrg2, Mrgprc11, Snsr1
Definition
(RefSeq) MAS-related GPR, member X1
  KO
K08396  Mas-related G protein-coupled receptor member X
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    282547 (Mrgprx1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Mas proto-oncogene and Mas-related (MRGs)
    282547 (Mrgprx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 282547
NCBI-ProteinID: NP_750845
RGD: 632284
Ensembl: ENSRNOG00000014242
UniProt: Q8R4G1 W8W3G5
Position
1q22
AA seq 337 aa AA seqDB search
MVCVLRDTTGRFVSMDPTISSLSTESTTLNKTGHPSCRPILTLSFLVPIITLLGLAGNTI
VLWLLGFRMRRKAISVYVLNLSLADSFFLCCHFIDSLMRIMNFYGIYAHKLSKEILGNAA
IIPYISGLSILSAISTERCLSVLWPIWYHCHRPRNMSAIICVLIWVLSFLMGILDWFFSG
FLGETHHHLWKNVDFIVTAFLIFLFMLLFGSSLALLVRILCGSRRKPLSRLYVTISLTVM
VYLICGLPLGLYLFLLYWFGIHLHYPFCHIYQVTVLLSCVNSSANPIIYFLVGSFRHRKK
HRSLKMVLKRALEETPEEDEYTDSHVQKPTEISERRC
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggtttgtgttctcagggacactactggaagatttgtgagcatggatccaaccatctca
tccctcagtacagaatctacaacactgaataaaactggtcatcccagttgcaggccaatc
ctcaccctgtccttcctggtccccatcatcaccctgcttggattggcaggaaacaccatt
gtactctggctcttgggattccgcatgcgcaggaaagccatctcagtctacgtcctcaac
ctgtctctggcagactccttcttcctctgctgccattttattgactctctgatgcggatc
atgaacttctatggcatctatgcccataaattaagcaaagaaatcttaggcaatgcagca
atcattccctatatctcaggcctgagcatcctcagtgctatcagcacggagcgctgcctg
tctgtattgtggccaatctggtaccactgccaccgcccaagaaacatgtcagctattata
tgtgttctaatctgggttctgtcctttctcatgggcatccttgactggttcttctcagga
ttcctgggtgagactcaccatcatttgtggaaaaatgttgactttattgtaactgcattt
ctgatttttttatttatgcttctctttgggtccagtctggcgctactggtgaggatcctc
tgtggttccagacggaaaccactgtccaggctgtacgttacaatctctctcacagtgatg
gtctacctcatctgcggcctgcctctcgggctttacttgttcctgctatattggtttggg
atccatttacattatcccttttgtcacatttaccaagttactgtgctcctgtcctgtgtg
aacagctctgccaaccccatcatttacttccttgtagggtcctttaggcaccgtaaaaag
catcggtccctcaaaatggttcttaagagggctctggaggagactcctgaggaggatgaa
tatacagacagccatgttcagaaacccactgagatctcagaaaggagatgttga

DBGET integrated database retrieval system