KEGG   Rattus norvegicus (rat): 282712Help
Entry
282712            CDS       T01003                                 

Gene name
Slc6a15, Ntt73
Definition
(RefSeq) solute carrier family 6 member 15
  KO
K05048  solute carrier family 6 (neurotransmitter transporter, amino acid/orphan) member 15/16/17/18/20
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    282712 (Slc6a15)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   282712 (Slc6a15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF Tmemb_18A
Motif
Other DBs
NCBI-GeneID: 282712
NCBI-ProteinID: NP_758824
RGD: 628664
Ensembl: ENSRNOG00000027468
UniProt: Q08469
Position
7q21
AA seq 729 aa AA seqDB search
MPKNSKVVKRDLDDDVIESVKDLLSNEDSVEDVSKKSELIVDVQEEKDTDAEDGSEVDDE
RPAWNSKLQYILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLLVIGIPLFFLELS
VGQRIRRGSIGVWNYISPKLGGIGFASCVVCYFVALYYNVIIGWTLFYFSQSFQQPLPWD
QCPLVKNASHTYIEPECEKSSATTYYWYREALAISSSISESGGLNWKMTGCLLAAWVMVC
LAMIKGIQSSGKIMYFSSLFPYVVLICFLIRSLLLNGSIDGIRHMFTPKLEMMLEPKVWR
EAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATLVVFAVLGFKA
NIVNEKCISQNSEMILKLLKTGNVSWDVIPRHINLSAVTAEDYHVVYDIIQKVKEEEFAV
LHLKACQIEDELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMFGTIE
GIITPVVDTFKVRKEILTVICCLLAFCIGLMFVQRSGNYFVTMFDDYSATLPLLIVVILE
NIAVSFVYGIDKFLEDLTDMLGFAPSKYYYYMWKYISPLMLVTLLIASIVNMGLSPPGYN
AWIKEKASEEFLSYPMWGMVVCFSLMVLAILPVPVVFVIRRCNLIDDSSGNLASVTYKRG
RVLKEPVNLDGDDASLIHGKIPSEMSSPNFGKNIYRKQSGSPTLDTAPNGRYGIGYLMAD
MPDMPESDL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaatagcaaagtagtaaagagagatttggatgatgatgtcattgaatctgtc
aaagacctcctgtccaatgaagactcagtggaagatgtttctaagaagagcgaactaatt
gttgatgttcaagaagagaaagatacagatgctgaagatggatctgaagttgatgatgaa
aggccagcttggaacagtaagctgcaatacatcctggcgcaagttggattttctgtaggt
ctggggaatgtgtggcggttcccatacctctgccaaaagaatggcggtggtgcatatctt
ttgccatatttaatactacttctggtgataggaattccactcttcttcttggaactttct
gtgggtcaaagaattcggagaggcagcatcggggtttggaattacataagccctaaactg
ggtgggattggattcgcaagctgtgtagtgtgctattttgtggctctctactacaatgtc
atcattggctggacattgttttacttttctcagtcttttcaacaacctctcccttgggat
caatgccccctggtgaaaaacgcatctcatacttatattgagccagaatgtgaaaaaagt
tctgccaccacttattactggtaccgggaagcactggctatcagcagctccatctctgaa
agtgggggcttaaactggaagatgactggctgcctgctggctgcctgggtcatggtttgt
ctggccatgatcaaaggcattcagtcctctggaaaaatcatgtattttagttctctgttc
ccctacgtggtacttatatgcttcctaataagatctctccttttaaatggttcaattgat
ggcatccgacacatgttcacccctaagcttgaaatgatgctggagcccaaggtttggaga
gaggcagcgactcaagtcttctttgccttgggtttgggatttggtggagtcatcgcgttt
tccagttacaacaagagagacaacaactgccacttcgacgctgtcctcgtgtcttttatc
aactttttcacttcagtcctggcaacactggtggtgttcgcagttctggggttcaaagcc
aatatcgtaaatgaaaagtgcatttcacaaaattctgagatgatcttgaaacttttgaaa
acgggaaacgttagttgggatgtcattccccgtcacatcaacctttcagctgtcactgcg
gaagattatcatgtagtttacgacatcattcaaaaagtgaaggaggaggagtttgctgtt
ctccatctcaaagcctgtcaaattgaggatgagctaaataaagctgtgcagggcactggc
ttggctttcattgcctttacagaggccatgacacattttcctgcatctcccttctggtca
gtgatgtttttcctcatgctgataaatctcgggctcggcagcatgtttggaaccattgaa
ggaatcatcactcctgttgtggacacattcaaagtgaggaaggaaatactcaccgttatc
tgttgcctcctagcattttgtatcggcttgatgtttgtgcagcgctctggaaattacttc
gttacaatgtttgatgattattctgccacattgcctctgttaatcgtggtcatcttggag
aatattgctgtaagcttcgtttacggcatagataagtttctagaagacctaacagacatg
ttaggatttgctccaagcaaatattactattacatgtggaaatacatttctcctctaatg
ctagtaacattgttaatagctagcattgtgaatatgggattaagtcctccgggatataat
gcatggatcaaggagaaggcatccgaagaatttctgagctacccgatgtgggggatggtg
gtctgtttctctctgatggtgctggctatacttcctgtcccagtcgttttcgtcattcgt
cgctgcaacctcatagatgatagttctggtaacttggcctctgtgacctataagagagga
agagtcctgaaagaacccgtgaacttagacggagatgatgcaagcctcattcacggaaag
ataccaagtgaaatgtcgtctccaaattttggtaaaaatatctatcgaaaacagagtggt
tctccgaccctggacactgctcccaatggacgctatgggattgggtatttgatggcagat
atgccagatatgcccgagtctgacttgtag

DBGET integrated database retrieval system