KEGG   Rattus norvegicus (rat): 282817Help
Entry
282817            CDS       T01003                                 

Gene name
Pycard, Asc
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    282817 (Pycard)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    282817 (Pycard)
   04623 Cytosolic DNA-sensing pathway
    282817 (Pycard)
   04625 C-type lectin receptor signaling pathway
    282817 (Pycard)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    282817 (Pycard)
   05133 Pertussis
    282817 (Pycard)
   05134 Legionellosis
    282817 (Pycard)
  09172 Infectious diseases: Viral
   05164 Influenza A
    282817 (Pycard)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PYRIN CARD
Motif
Other DBs
NCBI-GeneID: 282817
NCBI-ProteinID: NP_758825
RGD: 628637
Ensembl: ENSRNOG00000019675
UniProt: Q8CHK8
Position
1q37
AA seq 193 aa AA seqDB search
MGRARDAILDALENLTADEFKKFKMKLLTAPVREGYGRIPRGALLQMDPIDLTDKLVSYY
LEGYGLELTMSVLRDMGIQELAEQLQKIMEESGAVATATSVPAQGTARTEHFVDQHRQAL
IARVTKVDGLLDALYGNVLTEGQYQAVRAETPNQNKMRKLFSFAPAWNLTCKNLFLEALR
QTQPYLVTDLEQS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggggcgggcacgagatgccatcctggacgctcttgaaaacttgacagcggatgagttt
aaaaagttcaagatgaagctgctgacagcgccagtgcgggaaggctatgggcgcatccca
cggggggccctgctgcagatggaccccatagacctcactgataaactcgtcagctactat
ctggaggggtatggcttggagctcacaatgtctgtgcttagagacatgggcatacaggag
ctggctgagcagctgcaaaagattatggaagagtctggagctgtggctactgcaaccagt
gtccctgctcagggcacagccagaacagaacattttgtggaccaacacaggcaagcactc
attgccagggtcacaaaagttgatggtttgctggatgctctgtatggcaatgtgctgact
gaaggacagtaccaggcagttcgtgcagagacccccaaccaaaacaagatgaggaagctc
tttagctttgctccagcctggaacctgacctgcaagaacttgttccttgaggccttgagg
caaacacagccctacttggtgacagacctggaacagagctga

DBGET integrated database retrieval system