KEGG   Rattus norvegicus (rat): 282817
Entry
282817            CDS       T01003                                 

Gene name
Pycard
Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05135  Yersinia infection
rno05164  Influenza A
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    282817 (Pycard)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    282817 (Pycard)
   04623 Cytosolic DNA-sensing pathway
    282817 (Pycard)
   04625 C-type lectin receptor signaling pathway
    282817 (Pycard)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    282817 (Pycard)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    282817 (Pycard)
   05135 Yersinia infection
    282817 (Pycard)
   05133 Pertussis
    282817 (Pycard)
   05134 Legionellosis
    282817 (Pycard)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    282817 (Pycard)
SSDB
Motif
Pfam: PYRIN CARD CARD_2 Vta1
Other DBs
NCBI-GeneID: 282817
NCBI-ProteinID: NP_758825
RGD: 628637
Ensembl: ENSRNOG00000019675
UniProt: Q8CHK8
Position
1
AA seq 193 aa
MGRARDAILDALENLTADEFKKFKMKLLTAPVREGYGRIPRGALLQMDPIDLTDKLVSYY
LEGYGLELTMSVLRDMGIQELAEQLQKIMEESGAVATATSVPAQGTARTEHFVDQHRQAL
IARVTKVDGLLDALYGNVLTEGQYQAVRAETPNQNKMRKLFSFAPAWNLTCKNLFLEALR
QTQPYLVTDLEQS
NT seq 582 nt   +upstreamnt  +downstreamnt
atggggcgggcacgagatgccatcctggacgctcttgaaaacttgacagcggatgagttt
aaaaagttcaagatgaagctgctgacagcgccagtgcgggaaggctatgggcgcatccca
cggggggccctgctgcagatggaccccatagacctcactgataaactcgtcagctactat
ctggaggggtatggcttggagctcacaatgtctgtgcttagagacatgggcatacaggag
ctggctgagcagctgcaaaagattatggaagagtctggagctgtggctactgcaaccagt
gtccctgctcagggcacagccagaacagaacattttgtggaccaacacaggcaagcactc
attgccagggtcacaaaagttgatggtttgctggatgctctgtatggcaatgtgctgact
gaaggacagtaccaggcagttcgtgcagagacccccaaccaaaacaagatgaggaagctc
tttagctttgctccagcctggaacctgacctgcaagaacttgttccttgaggccttgagg
caaacacagccctacttggtgacagacctggaacagagctga

DBGET integrated database retrieval system