KEGG   Rattus norvegicus (rat): 282832Help
Entry
282832            CDS       T01003                                 

Gene name
Ccr9
Definition
(RefSeq) C-C motif chemokine receptor 9
  KO
K04184  C-C chemokine receptor type 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282832 (Ccr9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    282832 (Ccr9)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    282832 (Ccr9)
   04062 Chemokine signaling pathway
    282832 (Ccr9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    282832 (Ccr9)
   04050 Cytokine receptors [BR:rno04050]
    282832 (Ccr9)
   04090 CD molecules [BR:rno04090]
    282832 (Ccr9)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    282832 (Ccr9)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   282832 (Ccr9)
CD molecules [BR:rno04090]
 Proteins
  282832 (Ccr9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 282832
NCBI-ProteinID: NP_758832
RGD: 628750
Ensembl: ENSRNOG00000006311
UniProt: Q8CH33
Position
8q32
AA seq 369 aa AA seqDB search
MTPTEFTSLIPGMFDDYSYDSTASTDDYMNLNFSSFFCKKNNVRQFASHFLPPLYWLVFV
VGTVGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAAGQWMFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIVQAMKAQVWRQKRLLYSKMVCITIWVMAAVLC
TPEILYSQISGESGIAICTMVYPKDKNAKLKSAVLILKVTLGFFLPFMVMAFCYTIIIHT
LVQAKKSSKHKALKVTITVLTVFIMSQFPYNCILVVQAVDAYTMFISNCTISTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacacccacagaattcacaagccttattcctggcatgtttgatgactacagctatgat
tccactgcttccacagacgactacatgaatttgaacttcagtagcttcttctgtaagaaa
aacaatgtaaggcagtttgcgagtcatttccttccgcctctgtactggcttgtgttcgtt
gtgggtactgtgggcaacagcctggtcatccttgtctactggtactgcacaagagtgaag
acaatgaccgacatgttccttttgaatttggccattgctgatctgctctttcttgccact
cttcccttctgggccattgctgctgctggtcagtggatgttccagaccttcatgtgcaag
gttgtgaacagcatgtacaagatgaacttctacagctgtgtgctactcatcatgtgcatc
agtgtggacagatacattgccattgtacaggccatgaaggctcaggtctggaggcagaaa
aggctgctgtacagcaagatggtctgcattaccatctgggtgatggcagctgtgctctgc
accccagaaatcctgtacagtcaaatcagtggggaatctggcattgccatatgtaccatg
gtctaccctaaggataagaatgccaagctaaagtctgctgttttgatcctgaaggtcacc
ttggggtttttcctccccttcatggtcatggctttctgttacaccatcatcattcatact
ttggtacaggccaagaagtcatccaagcacaaggccctcaaggtgaccatcactgttctc
actgtcttcattatgtctcagttcccctacaattgcattctggtagtgcaggctgttgat
gcctacaccatgttcatctccaactgcaccatttccaccaacattgacatctgcttccag
gttactcagactattgcattcttccacagttgcctgaacccagttctctatgttttcgtg
ggtgagagattccgcagggatctggtaaagaccctgaagaacctgggatgcattagccag
gcccagtgggtttcattcacaaggagagagggtagcttgaagctttcttctatgctactg
gagacaacttctggagctctctccctgtga

DBGET integrated database retrieval system