KEGG   Rattus norvegicus (rat): 282833Help
Entry
282833            CDS       T01003                                 

Gene name
Zp4, Zp-4
Definition
(RefSeq) zona pellucida glycoprotein 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Zona_pellucida Trefoil
Motif
Other DBs
NCBI-GeneID: 282833
NCBI-ProteinID: NP_758833
RGD: 628708
Ensembl: ENSRNOG00000027506
UniProt: F1LP51
Position
17q12.1
AA seq 545 aa AA seqDB search
MARQALRSTLWLLPSILLCFPFCLPLSGQHVTELPGVLHCGLQSFQFAVNLSLEAESPVL
TTWDSQGLPHRLKNDSDCGTWVMDSPDGFLVLEASYSGCYVTLEGSHYIMTVGVQEADVA
GHVAGTRQRLLTCPLALQGKAPDTPSAKVCSPVPVKERLPCASSTISRGDCEELGCCYSS
EEEGADSCYYGNTVTSHCTKEGHFSIAVSRDVTSPPLRLDSLRLGFRNITTGCDPVMKTS
TFVLFQFPLTSCGTTQRITGDQAMYENELVAIRDVQAWGRSSITRDSNFRLRVSCTYSIH
SIMSPVNMQVWTLPPPLPKTQPGPLSLELQIAQDKNYSSYYGTDAYPLVKFLQDPIYVEV
SILHRTDPSLSLLLEQCWATPGSNPFHQPQWPILVKGCPYAGDNYQTKRIPVQKASDVFP
SHHQRFSISTFSFMSAGREKQVLGGQVYLHCSASVCQPAGMPSCTVICPASRRRRKSELY
FDNSTSISSKGPVILLQATKDPAVMLHKHSGTHADSPTLWVMGLSASMVITGVLVVSYLA
TRKQR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggctaggcaggctctaaggagcactctgtggcttctaccaagcatcttactgtgtttc
ccattctgtcttcctttgagtggccagcatgttaccgagttgccaggtgtgctccactgt
gggttacagagcttccagtttgctgtgaacctcagcctggaggcagagagtcctgtgcta
acaacttgggatagccaagggctgccacacaggcttaagaatgactctgactgtggtaca
tgggtgatggacagtcctgatggctttctggtcttggaagccagctacagtggctgctat
gtcactctggagggatcccactacatcatgaccgttggtgtgcaagaggcagatgtagct
ggacatgtagcaggaacaagacaaagactgcttacgtgccctttggctcttcagggtaaa
gccccagatacaccaagtgctaaagtgtgcagtcctgtgccagtaaaggaaaggctgccc
tgtgcttcctcgaccatctccagaggagactgtgaagagttggggtgctgctacagctct
gaagaggaaggggcagactcctgttactatggaaacacagtgacctcccattgcaccaag
gagggccacttttccattgctgtgtccagggacgtgacctcgccccctctgcgcttggat
tcacttcgcttaggcttcaggaacatcaccacagggtgtgatcctgtgatgaaaacatcc
acctttgtcctgttccaatttccacttacttcctgtgggactacacagcggatcactgga
gaccaggccatgtatgaaaatgagctagtggccattcgggatgtacaagcatggggcaga
agctctattactagagacagcaacttcaggctccgagtcagctgcacgtactccattcac
agcatcatgtccccagttaacatgcaagtgtggactctcccaccaccccttcctaagacc
cagcccggacccctctctctggaacttcagattgcccaggataaaaactacagctcttac
tacggtactgatgcctacccactggtaaaattcctccaggatcccatttacgtggaggtc
tccatccttcatagaacagacccctcgttgagcctgctgctagagcaatgttgggctaca
cctggctctaatccttttcatcaaccacaatggccaatcctagtgaagggatgcccatat
gctggagacaattatcagaccaaaaggatcccggttcagaaagcatcagatgtctttcca
tctcatcatcagcgcttcagtatctctaccttcagcttcatgagtgctggaagggagaag
caggttttgggtggacaggtatacctgcactgcagtgcatcggtctgccagcctgctggg
atgccatcctgcacggttatctgtcctgcttccaggagaagaagaaaatctgagctttat
tttgataactccaccagcatatctagcaaaggtcccgtgatcctcctccaagccactaag
gaccctgcagtcatgcttcataaacactcaggcacccatgcagattctcccactctgtgg
gtaatgggactttctgcaagcatggtcatcactggagtcttggtagtatcctacttggcc
accaggaaacagagatga

DBGET integrated database retrieval system