KEGG   Rattus norvegicus (rat): 282838
Entry
282838            CDS       T01003                                 

Gene name
Gm2a
Definition
(RefSeq) ganglioside GM2 activator precursor
  KO
K12383  ganglioside GM2 activator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    282838 (Gm2a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    282838 (Gm2a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   282838 (Gm2a)
SSDB
Motif
Pfam: E1_DerP2_DerF2 DUF1091
Other DBs
NCBI-GeneID: 282838
NCBI-ProteinID: NP_758838
RGD: 628651
Ensembl: ENSRNOG00000052219
UniProt: Q6IN37
Position
10
AA seq 199 aa
MRRVPLLLVLGLLFVLGLLFAGPVAPSRLISKRPSQLGGFSWDNCDEGKDPAVIKSLTLQ
PDPIVVPGDVIVSAEGKTSIPLTSPQKVELTVEKEVAGFWVKIPCVEQLGSCTYENVCDL
IDQYIPPGETCPEPLHTYGLPCHCPFKEGTYSLPSSNFTVPDLELPSWLSTGNYRIQSIL
SSGGKRLACIKIAASLKGK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgcgtcgtgtaccgctgctgctcgtgctgggcttgctgttcgtgctgggcttgctgttc
gctggccctgtcgccccttcgcgcctcatctcgaagcgcccttcccaacttggtggcttc
tcctgggataactgtgatgaaggaaaggaccctgcagtgatcaaaagcctcacgctccaa
cctgaccccattgtcgttcctggagatgtgatcgtcagtgctgagggcaagaccagcatt
cccctcacttctcctcagaaggtggagctcaccgtggagaaggaagtggctggcttctgg
gtcaagatcccttgcgtagaacagctaggaagctgtacctatgagaatgtctgtgacctg
atagaccaatacatcccccctggagagacctgcccagagccgctgcacacctacgggctg
ccctgccattgtcccttcaaggaaggcacctactcactgccttcgagcaacttcacagtg
cctgatctggagcttccaagctggctaagcacgggcaactaccgcatccagagcatcttg
agcagcggtggaaagcgcctggcctgcatcaagattgccgcctctctcaagggcaaataa

DBGET integrated database retrieval system