KEGG   Rattus norvegicus (rat): 286895Help
Entry
286895            CDS       T01003                                 

Gene name
Brinp2, Fam5b
Definition
(RefSeq) BMP/retinoic acid inducible neural specific 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF
Motif
Other DBs
NCBI-GeneID: 286895
NCBI-ProteinID: NP_775138
RGD: 708419
Ensembl: ENSRNOG00000005592
UniProt: Q8K1M8
Position
13q22
AA seq 783 aa AA seqDB search
MRWPCSSRFRGLWPEAAPWAVLLALGVPGWVLAVSATVAAVVPEQHVSSAGQAPLDWLLT
DRGPFHRAQEYADFMERYRQGFTTRYRIYREFARWKVNNLALERKDFFSLPLPLAPEFVR
NIRLLGRRPNLQQVTENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSRKSETLGGVPVV
GGTGNSSAVSLETLHQLAASYFIDRESTLRRLHHIQIATGAIKVTETRTGPLGCSNYDNL
DSVSSVLVQSPENKVQLLGLQVLLPEHLRERFVAAALSYITCSSEGELVCRENDCWCKCS
PTFPECNCPDADIQAMEDSLLQIQDSWATHNRQFEESEEFQTLLKRLPSDRFLNSTAISQ
YWTMDANLQHRYQQLGASLKVLLKKMHRIVRRLFNLCKRCHRQPRFRLPKERSLSFWWNR
IQSLLYCGESTFPGTFLEQSHSCTCPYDQSSCQGPIPCALGEGPACAHCASDNTTRCGSC
NPGYVLAQGLCRPEVAESLENFLGLETDLQDLELKYLLQKRDSRIEVHSIFISNDMRLGS
WFDPSWRKRMLLTLKSNKYKPGLVHVMLALSLQICLTKNSTLEPVMAIYVNPFGGSHSES
WFMPVNEGSFPDWERTNVDAAAQCQNWTITLGNRWKTFFETVHVYLRSRIKSLDDSSNET
IYYEPLEMTDPSKNLGYMKINTLQVFGYSLPFDPDAIRDLILQLDYPYTQGSQDSALLQL
IELRDRVNQLSPPGKVRLDLFSCLLRHRLKLANNEVGRIQSSLRAFNSKLPNPVEYETGK
LCS
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggccgtgcagctctcggtttagagggctttggccggaggccgccccatgggca
gtcctgctggcactaggcgtgcccgggtgggtgctggctgtctcggccacggtggccgct
gtggtcccggaacagcatgtctcctcggctggtcaggctcccctggactggctgctcaca
gaccgaggccccttccaccgtgcccaggagtatgctgatttcatggagcgttaccgccag
gggttcactaccagatacaggatctacagggagtttgcccgatggaaagtgaacaacttg
gccctagaaaggaaagacttcttcagtttgcccctgcctctcgccccagagtttgtccgc
aacatccgcctccttggaaggagacccaacctgcagcaggtcactgaaaacctcatcaaa
aagtacggcactcatttcttactttctgccactcttggaggagaagagtccctgaccatt
tttgtggacaagaggaaactaagcagaaagtcagaaacactaggaggtgttcctgtagtg
gggggcactgggaacagctctgctgtgtctctggaaaccctgcaccagctggcagcctcc
tacttcattgacagagagagcacactgcgaagacttcaccatatccaaatagccacaggg
gccataaaggtcacagagaccaggaccggtccactgggctgcagcaactatgacaatctg
gactctgtcagctctgtcctggttcagagtccagagaacaaagtgcagttattgggcctg
caggtgctgctccctgaacacctgcgtgagcggtttgtggctgcagcactcagctacatc
acatgcagctctgagggtgagcttgtctgcagggagaatgactgctggtgcaagtgcagc
cccacgttcccagaatgcaactgtcctgatgctgacattcaagctatggaagacagcttg
ctgcagatccaagactcctgggccactcacaacaggcagtttgaagagtcagaagaattc
cagaccctgctgaagaggctccccagcgaccgattcctgaactccacagccatctcccag
tactggaccatggacgccaacctccagcaccgttatcagcagctgggagccagcttgaaa
gtcctgttaaagaagatgcaccggatcgtccgccgcctcttcaatctctgcaagcgctgc
catcggcagcctcgcttccgcctgcccaaggagagatccttgtctttctggtggaaccga
atccagtcccttctctactgtggagaaagcaccttccctgggacattcctggaacagagc
cacagctgcacctgtccctatgaccaatcttcctgccagggccccattccatgtgccctg
ggggaagggcctgcatgtgcccactgtgcttcagacaataccacgcgctgtgggagttgt
aaccctggttatgtgctagcccagggactgtgccggccagaggtagccgagtccctggag
aactttcttgggctggagacagacctgcaggaccttgagctgaagtacctgctgcagaag
cgagatagccgcattgaggtgcactccatctttatcagcaatgacatgcgtctgggcagc
tggtttgacccttcctggaggaagcggatgctcctcactttgaagagtaacaagtacaag
ccgggcctggtgcatgtgatgttagccttgtccttgcagatctgcctcactaagaacagc
accctggagcccgtcatggccatctatgtgaaccccttcgggggcagccactctgagagc
tggttcatgcctgtaaacgagggcagctttccagactgggaaaggactaacgtggatgca
gctgcccagtgccaaaactggactatcactttggggaacaggtggaagactttttttgag
acagtccatgtttacctacggagccgaatcaagtccctggatgacagctccaacgagaca
atctactatgagcccctggagatgactgatccctccaagaatttgggctacatgaaaatc
aacactttgcaggtctttggctacagcctgccctttgacccggatgctatccgagactta
attctccagctggactacccgtacactcaaggttcccaggactctgcactcttacaactc
attgagcttagagaccgggtgaaccaactctctccccctggcaaagtccggcttgatctt
ttctcctgcttgctccgccataggctcaagctggccaacaacgaggtgggcaggatccag
tcctccctgagagctttcaattccaagctgccaaatcctgtggagtatgagacaggcaaa
ctctgtagctaa

DBGET integrated database retrieval system