KEGG   Rattus norvegicus (rat): 286908
Entry
286908            CDS       T01003                                 

Gene name
Pdlim7
Definition
(RefSeq) PDZ and LIM domain protein 7
  KO
K19867  PDZ and LIM domain protein 5/6/7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    286908 (Pdlim7)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   286908 (Pdlim7)
SSDB
Motif
Pfam: LIM PDZ PDZ_6 DUF4749 PDZ_2 TF_Zn_Ribbon Rv0078B
Other DBs
NCBI-GeneID: 286908
NCBI-ProteinID: NP_775148
RGD: 628769
Ensembl: ENSRNOG00000013653
UniProt: Q9Z1Z9
Position
17
AA seq 457 aa
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPAQSKPQKALTPPADPPRYTFAPSASLNKTARPFG
APPPTDSALSQNGQLLRQLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEFMKKSSQVPRTEAPAPASTIPQESWPGPTTPSPTSRPPWAVDPAFAERYAPDKTS
TVLTRHSQPATPTPLQNRTSIVQAAAGGGTGGGSNNGKTPVCHQCHKIIRGRYLVALGHA
YHPEEFVCSQCGKVLEEGGFFEEKGAIFCPSCYDVRYAPSCAKCKKKITGEIMHALKMTW
HVPCFTCAACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGCDFKIDAGDRFLEALGFS
WHDTCFVCAICQINLEGKTFYSKKDKPLCKSHAFSHV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggattccttcaaggtagtgctggagggacctgccccttggggcttccgtctgcaaggg
ggcaaggacttcaacgtgcccctctccatctctcggctcactcctggaggcaaggccgca
caggccggtgtggccgtgggagactgggtactgagtatcgacggtgagaacgccggaagc
ctcacacacattgaagcccagaacaagatccgtgcctgtggggagcgcctcagcctgggt
cttagcagagcccagcctgctcagagcaaaccacagaaggccctgacccctcccgccgac
cccccgaggtacacttttgcaccaagcgcctccctcaacaagacggcccggcccttcggg
gcacccccacctactgacagcgccctgtcgcagaatggacagctgctcagacagctggtc
cctgatgccagcaagcagcggctgatggagaatactgaagactggcgcccgcggccaggg
acaggccagtcccgttccttccgcatccttgctcacctcacgggcacagagttcatgcaa
gacccggatgaggaattcatgaagaagtcaagccaggtgcccaggacagaagccccagcc
ccagcctcaaccataccccaggaatcctggcctggccccaccacccccagccccaccagc
cgcccaccctgggccgtagatcctgcatttgctgagcgctatgccccagacaaaaccagc
acagtgctgacccgacacagccagccagccacacctacgcctctgcagaaccgcacctcc
atagttcaggctgcagctggagggggcacaggaggaggcagcaacaatggcaagacgcct
gtatgccaccagtgccacaagatcatccgcggccgatacctggtagcactgggccacgcg
taccatcctgaggaatttgtgtgcagccagtgtgggaaggtcctggaagagggtggcttc
ttcgaggagaagggagctatcttttgcccctcctgctatgatgtgcgctatgcacccagc
tgtgccaaatgcaagaagaagatcactggagagatcatgcatgcgctgaagatgacctgg
catgttccctgcttcacctgtgcagcctgcaaaacccctatccgcaacagggctttctac
atggaggagggggctccctactgcgagcgagattacgagaagatgtttggcacaaagtgt
cgcggctgtgacttcaagatcgatgccggggaccgtttcctggaagccctgggtttcagc
tggcatgatacgtgttttgtttgcgcaatatgtcaaatcaacttggaaggaaagaccttc
tactccaagaaggacaagcccctgtgcaagagccatgccttctcccacgtatga

DBGET integrated database retrieval system