KEGG   Rattus norvegicus (rat): 286910Help
Entry
286910            CDS       T01003                                 

Gene name
Smim3, Nid67
Definition
(RefSeq) small integral membrane protein 3
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Smim3 Epiglycanin_C DUF4305 Renin_r
Motif
Other DBs
NCBI-GeneID: 286910
NCBI-ProteinID: NP_775149
RGD: 628864
Ensembl: ENSRNOG00000019536
Vega: OTTRNOG00000000142
UniProt: Q99PE6
Position
18q12.1
AA seq 60 aa AA seqDB search
MDAISQSPVDVLLPKHILDIWAIVLIILATVVIMTSLFLCPATAVIIYRMRTHPVLNGAV
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atggatgctatcagccaatcccctgtggatgtcctactgcccaagcatatcctggatatc
tgggccattgtcctcatcatcctggctaccgtcgtcatcatgacctccttgttcctgtgc
ccggccacggcagtcatcatctatcgaatgcggactcatccagttctcaacggggccgtc
tga

DBGET integrated database retrieval system