KEGG   Rattus norvegicus (rat): 286914Help
Entry
286914            CDS       T01003                                 

Gene name
Vom2r27
Definition
(RefSeq) vomeronasal 2 receptor, 27
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_3 ANF_receptor NCD3G Ephrin_rec_like
Motif
Other DBs
NCBI-GeneID: 286914
NCBI-ProteinID: NP_775153
RGD: 708442
Ensembl: ENSRNOG00000048635
UniProt: O35269
Position
1q12
AA seq 779 aa AA seqDB search
MRFAIEEINSNPHLLPNTSLGFEINNVPHGQRYTLVKLFSSLSGSNYDIPNYISASESNS
AAVLTGPSWTISECVGTLLDLYKFPQLTFGPFDSLLSEQRRFSSLYQVAPKDTFLTPGIV
SLMLHFHWNWVGLFIIDDDKGAQTLSDLRNEMDKNGVCTAFVEMIPVIKGSFFTKSWKNH
VQILESSSNVIIIYGDSDSLLSLIVNIKQKLLTWKVWVLISQWDVSKFDDYFMVDSLHGA
LIFSHHREEIPNFTDFMQKYNPSKYPEDTYLHVLWHMYFNCSFVKKDCKIVHNCLPNASL
GFLPGNIFDMAMSEESYNVYNAVYAVAHSLHEMILNQVQFQTHEKGKKMVFFPWQLHPFL
RERQLINQNGANEDLDCTRKSHVEYDILNFWNFPKGLGLNVKVGTFSPSAPKEQKLSISS
NMIQWATGSTEIPQSVCSESCHPGFRKTHQEGRVACCFDCIPCPENEISNETDVDQCVKC
PETHYANIEKIHCLQKTVTFLYYDDPLGKTLCFMSLGFSSLTAAVLVVFLKNRDTPIVKA
NNLALSYTLLITLMLCFLCPLLFIGRPSTASCILQQNIFGLLFTVALSTVLAKTITVVIA
FKITSPGRIRRWLLISRAPNFIIPLCTLLQVFLSGIWLTTSPPFIDKDAHSEHGHIIIIC
NKGSAVAFHCNLGYLGALALVSYFMAFLSRNLPDTFNEAKFLAFSMLVFCSVWVTFLPVY
HSTKGKNMVAMEVFSILASSTSLLGIIFAPKCYLILLRPERNSLSYIRDKTYAKSIKPS
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgccattgaggaaatcaacagcaatccccatcttttaccaaacacatccctg
ggatttgagatcaataatgtcccacacggtcagaggtacactctggtcaaactttttagc
tcactttcagggtctaattatgacattcctaactacataagtgcaagtgagagcaattct
gctgctgtacttacaggaccatcgtggacaatatctgaatgcgtagggacactcctggat
ctttacaaatttccacagcttacttttgggccttttgatagtctcctgagtgaacaaaga
cggttttcttctctgtaccaagtggcccccaaagatacatttctgacgcctggcattgta
tctttgatgcttcatttccactggaactgggtggggttattcatcatagatgatgacaaa
ggtgcccagacactgtcagacttgagaaatgagatggataaaaatggagtctgcacagca
tttgtagaaatgatcccagtcatcaagggttcattttttaccaaatcctggaaaaatcat
gtgcagatcctggaatcatcatcaaatgtgattattatttatggggactctgattctcta
ttaagcttaatagtaaatattaagcagaagttgctcacatggaaagtgtgggtactgatc
tcacagtgggatgtttctaaatttgatgattatttcatggtagactcattgcatggagct
cttattttttcacaccatcgtgaggagattcctaattttacagattttatgcagaagtac
aacccttccaagtacccggaagacacttatcttcatgtattgtggcacatgtacttcaat
tgctcatttgttaagaaagattgtaaaattgtgcacaactgtttgcctaatgcctccctg
gggttcttgcctgggaacatatttgacatggccatgagtgaagagagttacaatgtatac
aatgctgtgtatgctgtggcccacagtctgcatgagatgattctcaaccaagtacaattt
caaactcatgaaaaaggaaaaaagatggtattctttccttggcagcttcacccctttcta
agggaaagacaactcatcaatcagaatggagcgaatgaagatctggattgtaccaggaag
tcacatgtagagtatgacattctcaacttttggaatttcccaaaaggtcttgggctaaat
gtgaaagtaggaacgttttctccaagtgctccaaaggaacagaaactgtccatatcttct
aacatgatacagtgggccacagggtcgacagagattccacagtctgtatgcagtgagagc
tgtcatcctggattcaggaaaacccaccaggaaggcagggttgcctgttgctttgactgc
attccttgtccagaaaatgagatctccaatgagacagatgtggatcagtgtgtgaagtgt
ccagaaactcactatgcaaacatagagaagatccactgcctacagaaaactgtgacattt
ctgtactatgatgacccattggggaagacactttgcttcatgtccctgggtttctcctca
ctcacagctgctgttcttgtggtgtttctgaagaacagggacacccccattgtcaaggcc
aataacctggctctcagttacaccctgctcatcactttgatgctctgttttctctgtccc
ttgctcttcattggccgtcccagcacagcctcctgtatcctgcagcaaaacatttttggg
cttctgttcactgtggctctttccactgtgttggccaaaactatcactgtggttatagcc
ttcaagatcacttctccaggaagaattagaagatggctgctgatatcaagggcccctaat
ttcattattcccttatgcaccctgctccaagtttttctatctggaatttggctgacaacc
tctcctccatttattgataaagatgctcactcagaacatggacacatcatcatcatttgc
aataaaggctcagctgttgctttccattgcaaccttggatacctgggagcactagcccta
gtgagctactttatggctttcttgtccagaaacctacctgacacattcaatgaagccaag
ttcctggctttcagcatgctggtgttctgcagtgtctgggtcaccttcctccctgtctac
cacagcaccaaggggaagaacatggtggctatggaagtcttctctatcttggcttccagt
acatctctcctaggcatcatctttgcccccaagtgctacctcatattattaagaccagaa
aggaattcacttagctatatcagggacaaaacatatgctaaaagcataaaaccttcttag

DBGET integrated database retrieval system