KEGG   Rattus norvegicus (rat): 286918Help
Entry
286918            CDS       T01003                                 

Gene name
Mx2, Mx3
Definition
(RefSeq) MX dynamin like GTPase 2
  KO
K14754  interferon-induced GTP-binding protein Mx1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    286918 (Mx2)
   05164 Influenza A
    286918 (Mx2)
   05160 Hepatitis C
    286918 (Mx2)
   05165 Human papillomavirus infection
    286918 (Mx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 CHDNT AAA_29 ABC_tran AAA_16
Motif
Other DBs
NCBI-GeneID: 286918
NCBI-ProteinID: NP_599177
RGD: 628821
Ensembl: ENSRNOG00000001963
UniProt: Q499Q3
Position
11q12
AA seq 659 aa AA seqDB search
MVLSTEENRSVDLVNLPSVPLPDGEAGVGENNKDSLNNLCSQYEEKVRPCIDLIDSLRAL
GVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLNQGEEWKG
KVTYDDIEVELSDPSEVEEAINTGQNHIAGVGLGISDKLISLDVSSPHVPDLTLIDLPGI
TRVAVGNQPADIGRQIKRLITNYIQKQETINLVVVPSNVDIATTEALSMAQKVDPDGDRT
IGILTKPDLVDRGTEDKVVDVVRNLVCHLKKGYMIVKCRGQQDIQEQLSLAEALQKEQVF
FKEHPQFRALLEDGKATVPCLAERLTMELISHICKSLPLLENQIKESHQSTSEELQKYGA
DIPEDENEKTLFLIEKINAFNQDITAIVEGEEIVREKECRLFTKLRKEFFLWSEEIERNF
QKGSDALYKEVYTFEMQYRGRELPGFVNYKTFENIIRRQIKTLEEPAMEMLHKVTEIVRA
AFTTVSEKNFSEFFNLHRTTKSKLEDIRLEQETEAEKAIRLHFQMEQIIYCQDQIYRKAL
QKVREEEAEEEERKHGKSRSAQSPNLQTSSMDEIFQHLNAYRQEAHNCISSHIPLIIQYF
ILKMFAEKLQKGMLQLLQDKDSCSWLLKEKSDTSEKRRFLKERLARLAQAQRRLAKFPG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggttcttagcacagaggaaaacaggagtgttgatttagtcaacttacccagtgtccca
ctgcccgatggagaggctggcgtaggggagaacaacaaggattccttgaacaacctctgc
agtcagtatgaggagaaggtgcggccctgcattgacctcatcgactccctgcgagctctg
ggtgtggagcaagacctggccctgcctgccatcgctgtcatcggggaccagagttcaggg
aagagctctgtgctggaagcactgtctggagtggccctccccagaggcagtggtattgtc
accagatgtcccctggtgctgaaattgaagaagctgaatcagggagaggagtggaaaggc
aaagtcacctatgatgacatcgaagtggagctctctgatccttcagaggtggaagaggcc
atcaacacaggtcagaaccatattgctggggtagggctggggatcagtgataaactcatt
agcctggatgtcagctccccacacgtcccagacctgactctgattgaccttcctggaatc
accagggtggctgtaggcaaccagcctgcagacataggacggcagatcaagagacttatc
actaactacatccaaaaacaagagaccatcaacctggtggtggtccccagcaatgtggac
attgccaccacagaggccctgagcatggctcagaaggtggaccctgatggggataggacc
atagggatcttgaccaagcctgatctggtggacagagggactgaagacaaggtcgtggat
gtggtgaggaacctcgtgtgccacctgaagaagggctacatgatagtcaagtgcaggggt
cagcaggacatccaggagcagctgagcctggctgaggctcttcagaaggagcaagtcttc
ttcaaggaacaccctcaattcagagctcttctggaggatgggaaggccacagtgccctgc
ctggcagagaggctgaccatggagctcatctcacacatctgtaaatctcttcctttgtta
gaaaatcaaataaaggaaagtcaccagagtacaagtgaggagctgcagaagtatggtgca
gacataccagaagatgagaatgaaaaaactctcttcctgattgaaaaaatcaatgctttt
aaccaggacatcactgccatagtagaaggggaagagattgtgagggagaaagaatgtcgc
ctattcaccaagctccgtaaagagttcttcttgtggagtgaggagatcgaaaggaatttc
caaaaaggttctgatgctttatataaagaagtctacacattcgaaatgcagtatcgtggc
cgagaactaccagggtttgtgaattacaaaacatttgagaacatcataagaagacaaatc
aaaaccctggaagaaccagctatggaaatgcttcacaaggtcactgaaattgtacgggct
gcctttacaacggtttctgagaaaaatttctctgagttttttaatctccacagaactacc
aagtccaaacttgaagacatcagattagaacaggaaacggaagcagagaaggcgatccgg
cttcacttccagatggaacaaatcatctactgccaggaccaaatttataggaaagccttg
cagaaggtgagagaggaggaagctgaggaggaggagaggaagcatggcaaaagcaggtcc
gctcagtccccaaatttacagacctcatccatggatgaaatcttccagcatctgaatgcc
taccgccaggaggctcacaactgcatctccagccacattccattgatcatccagtatttc
atcttgaagatgtttgctgagaagctgcagaagggcatgctccagctcctgcaggacaag
gattcctgcagctggctcctgaaggaaaagagtgacaccagtgagaagaggagattcctg
aaggagcggttggcaaggctggcccaagctcagcgcaggctagccaaattccctggttaa

DBGET integrated database retrieval system