KEGG   Rattus norvegicus (rat): 286920Help
Entry
286920            CDS       T01003                                 

Gene name
Asic3, Accn3
Definition
(RefSeq) acid sensing ion channel subunit 3
  KO
K04830  acid-sensing ion channel 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    286920 (Asic3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    286920 (Asic3)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   286920 (Asic3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC
Motif
Other DBs
NCBI-GeneID: 286920
NCBI-ProteinID: NP_775158
RGD: 708578
Ensembl: ENSRNOG00000008380
UniProt: O35240
Position
4q11
AA seq 533 aa AA seqDB search
MKPRSGLEEAQRRQASDIRVFASSCTMHGLGHIFGPGGLTLRRGLWATAVLLSLAAFLYQ
VAERVRYYGEFHHKTTLDERESHQLTFPAVTLCNINPLRRSRLTPNDLHWAGTALLGLDP
AEHAAYLRALGQPPAPPGFMPSPTFDMAQLYARAGHSLEDMLLDCRYRGQPCGPENFTVI
FTRMGQCYTFNSGAHGAELLTTPKGGAGNGLEIMLDVQQEEYLPIWKDMEETPFEVGIRV
QIHSQDEPPAIDQLGFGAAPGHQTFVSCQQQQLSFLPPPWGDCNTASLDPDDFDPEPSDP
LGSPRPRPSPPYSLIGCRLACESRYVARKCGCRMMHMPGNSPVCSPQQYKDCASPALDAM
LRKDTCVCPNPCATTRYAKELSMVRIPSRASARYLARKYNRSESYITENVLVLDIFFEAL
NYEAVEQKAAYEVSELLGDIGGQMGLFIGASLLTILEILDYLCEVFQDRVLGYFWNRRSA
QKRSGNTLLQEELNGHRTHVPHLSLGPRPPTTPCAVTKTLSASHRTCYLVTRL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcgctccggactggaggaggcccagcggcgacaggcctcagacatccgggtg
tttgccagcagctgcacaatgcatggtctgggccacatctttggccctggaggcctgacc
ctgcgccgagggctgtgggccacagctgtgctcctgtcgctggcggccttcctctaccag
gtggctgagcgggttcgctactatggggagttccaccataagaccaccctggatgagcgt
gagagccaccagctcaccttcccagctgtgactctgtgtaatatcaacccactgcgccgc
tcacgcctcacacccaatgacttgcactgggctggaacagcgctgctgggcctggaccct
gctgaacatgctgcctaccttcgtgcactgggccagccccccgcaccacctggcttcatg
cccagtccgacctttgacatggcacaactctacgccagagccggccactcccttgaggac
atgttgttggattgccgataccgtggccagccctgtgggcctgagaacttcacagtgatc
tttactcgaatggggcaatgctacaccttcaactctggtgcccacggtgcagagctgctc
accactccaaagggtggtgctggcaacggactggagattatgctagatgtacagcaagag
gagtatctgcccatctggaaggacatggaagagaccccgtttgaggtggggatccgagtg
cagattcacagccaggatgagccccctgccattgaccagctgggcttcggggcagcccca
ggccatcagacttttgtgtcctgtcagcagcagcaactgagtttcctgccaccaccctgg
ggtgactgcaataccgcatctttggatcccgacgactttgatccagagccctctgatccc
ttgggttcccccagacccagacccagccctccttatagtttaataggttgtcgcctggcc
tgtgagtctcgctatgtggctcggaagtgtggctgtcgaatgatgcatatgcctggaaac
tccccagtgtgcagcccccagcagtacaaggactgcgccagcccagctctggacgctatg
ctgcgaaaggacacgtgtgtctgccccaacccgtgcgctactacacgctatgccaaggag
ctctccatggtgcggattcccagccgcgcgtcagctcgctacctggcccggaaatacaac
cgcagcgagtcctacattacggagaatgtactggttctggatatcttctttgaggccctc
aactatgaagcggtggaacaaaaggcggcctatgaagtgtcggagctgctgggagacatt
gggggacagatgggactgtttattggagcaagcctgcttaccatccttgagatcctcgac
tatctctgtgaggttttccaagacagagtcctggggtatttctggaacagaaggagcgct
caaaagcgctctggcaacactctgctccaggaagagttgaatggccatcgaacacatgtt
ccccacctcagcctagggcccaggcctcctaccactccctgtgctgtcaccaagacactc
tctgcctcccaccgtacctgttacctcgtcacaaggctctag

DBGET integrated database retrieval system