KEGG   Rattus norvegicus (rat): 286924Help
Entry
286924            CDS       T01003                                 

Gene name
Gnat3, gnat-3
Definition
(RefSeq) G protein subunit alpha transducin 3
  KO
K19729  guanine nucleotide-binding protein G(t) subunit alpha 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04742  Taste transduction
rno04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    286924 (Gnat3)
  09157 Sensory system
   04742 Taste transduction
    286924 (Gnat3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    286924 (Gnat3)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    286924 (Gnat3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 286924
NCBI-ProteinID: NP_775162
RGD: 727817
Ensembl: ENSRNOG00000005268
UniProt: P29348
Position
4q11
AA seq 354 aa AA seqDB search
MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNG
YSKQECMEFKAVVYSNTLQSILAIVKAMTTLGIDYVNPRSREDQQLLLSMANTLEDGDMT
PQLAEIIKRLWGDPGIQACFERASEYQLNDSAAYYLNDLDRLTAPGYVPNEQDVLHSRVK
TTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDEEV
NRMHESLHLFNSICNHKYFATTSIVLFLNKKDLFQEKVTKVHLSICFPEYTGPNTFEDAG
NYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtggaattagttcagagagcaaggagtcagccaaaaggtccaaagaactggag
aagaagcttcaggaagatgctgaacgagatgcaagaactgtgaagttgctgctattagga
gcaggtgaatctggaaaaagtactattgttaaacaaatgaagatcatccacaagaatggt
tacagtaaacaagaatgcatggagtttaaagcagtggtttacagtaacacgttgcagtcc
atcctggccattgtgaaagccatgactacactagggattgattatgtcaatccgagaagt
agagaggaccaacaactgcttctctccatggcaaacacactagaagatggtgacatgacg
cctcagttggctgaaataattaaacgtctgtggggcgatccaggaattcaagcctgcttc
gaaagggcatctgaataccagctcaatgactctgcagcttactaccttaatgacttagat
agactcacagcccctgggtatgtgccaaatgaacaagacgttctacattcccgggtgaaa
accactggtatcattgaaactcaattctcctttaaagacttgaacttcagaatgtttgat
gtaggtggccagagatcagaaagaaagaaatggatccactgctttgaaggagtgacgtgc
attatattttgtgcagccctaagtgcctacgacatggtacttgtagaagatgaagaggtg
aacagaatgcatgaaagtcttcacctcttcaacagcatctgtaatcacaagtattttgca
accacctccattgttctgtttcttaacaagaaagatctcttccaggagaaagtgaccaag
gtgcacctcagcatctgtttcccagaatacactggaccaaatacattcgaagatgcaggg
aactacatcaagaaccagttcctagacctgaacttaaaaaaagaagataaggaaatctat
tctcacatgacctgcgctactgacacacaaaacgtcaaattcgtgtttgatgccgtgaca
gatataataataaaagagaacctcaaagactgtgggctcttctga

DBGET integrated database retrieval system