KEGG   Rattus norvegicus (rat): 286925
Entry
286925            CDS       T01003                                 

Gene name
Cryba2
Definition
(RefSeq) crystallin, beta A2
  KO
K23482  beta-crystallin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    286925 (Cryba2)
SSDB
Motif
Pfam: Crystall Inhibitor_I36
Other DBs
NCBI-GeneID: 286925
NCBI-ProteinID: NP_775163
RGD: 628768
Ensembl: ENSRNOG00000017996
UniProt: Q8CGQ0
Position
9q33
AA seq 197 aa
MSSAPAPGPAPACLTLWDEEDFQGRRCRLLSDCANVCERGALRRVRSVKVENGAWVAFEY
PDFQGQQFILEKGDYPCWSAWSGSSGHHSNQLLSFRPVLCANHSDSRVTLFEGENFQGCK
FELSDDYPSLPSMGWTSKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFRTYNDF
GTQAHTGQLQSIRRVQH
NT seq 594 nt   +upstreamnt  +downstreamnt
atgagcagcgccccggcaccgggcccggcacccgcttgcctcacgctctgggacgaggag
gacttccagggtcgtcgctgccggctactgagcgactgtgccaacgtctgtgagcgggga
gccctgcggagggtgcgctcagtcaaggtggaaaacggcgcatgggtggcctttgagtac
cccgacttccagggacagcagttcattctagagaagggagactatccttgctggagtgcc
tggagcggtagcagcggccaccacagcaaccaattgctgtccttcaggccagtgctctgt
gcgaaccacagtgacagccgtgtgaccctgtttgagggggaaaacttccagggctgcaag
tttgaactcagtgatgactacccatcactgccttccatgggctggaccagcaaagatgtg
ggttccctcaaagtcagctctggagcgtgggtggcctaccaataccctggctaccgaggc
taccagtatgtcttagaacgggaccggcacagtggggagttccgtacctacaatgacttt
ggcacacaggcccatactggacagctgcagtccattcgaagagtccagcattag

DBGET integrated database retrieval system