KEGG   Rattus norvegicus (rat): 286927
Entry
286927            CDS       T01003                                 

Gene name
Stk16, F52, PKL12
Definition
(RefSeq) serine/threonine kinase 16
  KO
K08856  serine/threonine kinase 16 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    286927 (Stk16)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     286927 (Stk16)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   286927 (Stk16)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo
Other DBs
NCBI-GeneID: 286927
NCBI-ProteinID: NP_775165
RGD: 629474
Ensembl: ENSRNOG00000019294
UniProt: P57760
Position
9q33
AA seq 305 aa
MGHALCVCSRGTVIIDNKRYLFVQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDQE
EAQREADMHRLFQHPNILRLMAYSLKERGAKHEAWLLLPFFKRGTLWNEIERLKDQGNFL
TEDQILPLLLGICRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIQVEGS
RQALALQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQ
KGDSVALAVQNDLSIPQSPRHSSALRQLLASMMTVDPQQRPHIPVLLSQLEALQPPAPGQ
HTTQI
NT seq 918 nt   +upstreamnt  +downstreamnt
atgggccatgcactgtgtgtctgttcccggggaactgtcatcattgacaataagcgttac
ctcttcgtccagaaattgggggagggtgggttcagctacgtggacctagtggagggctta
catgatggacacttctacgccctgaagcgaatcctgtgtcatgagcagcaggaccaggaa
gaggcccaacgagaggcagacatgcatcgcctcttccagcatccaaacatccttcgcctc
atggcttactctttgaaagaacgaggtgctaagcatgaagcctggctgctgctacccttc
ttcaagagaggtacactgtggaatgagatagaaaggctgaaggaccaaggcaacttcctg
actgaagaccaaatccttccgttgttgctgggtatctgcagaggccttgaggccattcat
gccaaaggttatgcacacagggacctgaagcccaccaatattttgcttggtgatgagggg
cagccggttttaatggacttgggttctatgaatcaagcatgcatccaagtggagggatct
cgccaggccctagctctacaggactgggcagcccagcggtgcaccatctcctaccgggca
cctgaacttttttctgtgcaaagccactgtgtcatcgatgagcggactgatgtctggtcc
ctaggctgtgtgctttatgcaatgatgtttggggaaggcccttatgatatggtgttccag
aaaggtgacagtgtggcccttgctgtgcagaatgacctcagcatcccacaaagccccagg
cattcttcagcattgcgacagctgttggcctctatgatgactgtggacccccagcaacgc
cctcacatccctgtcctcctcagtcaattggaggcattgcagccaccagctcctggccag
cacaccacccaaatctga

DBGET integrated database retrieval system