KEGG   Rattus norvegicus (rat): 286931
Entry
286931            CDS       T01003                                 

Gene name
Unc13c
Definition
(RefSeq) protein unc-13 homolog C
  KO
K15293  protein unc-13 A/B/C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    286931 (Unc13c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    286931 (Unc13c)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    286931 (Unc13c)
SSDB
Motif
Pfam: MUN C2 C1_1 FlaC_arch
Other DBs
NCBI-GeneID: 286931
NCBI-ProteinID: NP_775169
RGD: 628592
Ensembl: ENSRNOG00000056612
UniProt: Q62770
Position
8
AA seq 2204 aa
MVASLFKSLILAYIHKLCKGMFTKKLGNTTKKKENRQQNKDQDFPTAGHTKPPKLSNALK
STVKKIAKCSSTRNFSVEDEEGHKDFSLSPTFSYRVAIANGLQTAVTNSDEDLLQELSSI
ESSYSESFNELRSSTENQVQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHTLKLGALRK
LRKWKKSQECVSSDSELSTVKKTWGIRSKSLDRTARNPKTNVLEPGFSSSGCISQTHDVM
EMIFKELQGISQIETELSELRGHVNALKYSIDEISSSVEVVQSEIEQLRTGFVQARRETR
DIHDYIKHLGHMGSKVSLRFLNVPEERHEYVESVVYQILVDKMGFSDVPNAIKIEFAQRI
GQQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIAISTDILTYDIRERKEKGVLP
SSQTYESMDMKLSTPEPKAKKNAWLSPNDSDRELESDLSRSSYADSPAKGSSSKSSSKSH
SARSKNKAANSRTSQKSDYNKRPSKPPASEKPTPHYVEATPLWHSQSDFFTPKLSRSESD
FSKLCQSYSEDFSESQFFCRTNGSSLLSSSDRELWQRKQEGMTALYHSPQDQGLDGNIPT
VPGQGEIENTETVDSGMSNSVVCASGDRSNYSGSQLSLHEDLSPWKEWNQAGHGTDGLDS
STQEPFDYDTNSLSDQQLDMSSKDLDDLGKCHSDLQDDSESYDLTQDDNSSPCPGLDNEP
QGQWVGQYDSYQKTNSNDLYPNQSHPSMMYRSQSELQSDDSEAAQPKSWHSRLSIDLSDK
TFKFPKFGSTLQRAKSALEVVWNKSTQSLSGCEDSGSSLMGRFRTLSQSTANESSTTLDS
DIYTEPYYYKAEEEEDYCEPVADSETDYVEVMEQVLAKLENRTSVTEVDEHIKEYDHPSY
ETPYETPQDEGYDGQADDIISEGELETLNEPAVEMELVEDESQNLPVEPPEVMKPKRIRP
SFKEAALRAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFSALQVFGGAGRGLY
GIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHVFRKTLQALIY
PISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLNADCLQR
AAEKSSKHGAEDKTQTIITAMKERMKIRERNRPEVFEVIQEMFQISKEDFVQYTKAAKQS
VLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIFGNLNPVWDEK
FYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLSGEMDVWYNLE
KRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSNGSVKIPEVKG
DEAWKVFFDDASQEIVDEFAMRYGVESIYQAMTHFSCLSSKYMCPGVPAVMSALLANINA
FYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRENFPASNSERLQ
DLKSTVDLLTSITFFRMKVLELQSPPKASAVVKDCVRACLDSTYKYIFDNCHELYSQLID
PSKKQDVPREEQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQELNMGKISAEI
MWSLFALDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKDAVPEYSLWFE
PFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVFAQLNQSFEIIKKL
ECPNPEALSHLMRRFAKTINKVLVQYAAIVSSDFSSYCDKETVPCILMNNIQQLRVQLEK
MFESMGGKELDPEASTILKELQIKLNGVLDALSVTYGESFQLVIEECIKQMGAELNQMRA
NGNSAANKNNAAMDAEIVLRPLMDFLDKILSLSAKICEKTVLKRVLKELWKLVLNKIEKQ
IVLPPLTDQTGPQMIFIAAKELGQLSKLKEHMIRDDAKGLTPRQCAIMEVVLATIKQYFH
AGGNGLKKNFLEKSPDLHSLRYALSLYTQTTDALIKKFIETQGSQSRSSKDAVGQISVHV
DVTTTPGTGEHKVTVKVIAINDLNWQTTTMFRPFVEVCMLGPSLGDKKRKQGTKTKSNTW
SPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGSYGAWYP
LLKNLSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSIDESA
NT seq 6615 nt   +upstreamnt  +downstreamnt
atggtggctagtctctttaagagcttgattttagcttatatacataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaccaaaaagaaagaaaatcgtcagcagaataaa
gatcaagatttccctactgctggccacaccaaaccccctaaattgtccaatgccctgaaa
agcactgtaaaaaagattgcaaagtgctcatccacccgtaacttctccgtagaagacgaa
gaaggtcacaaagacttctccctgtcacccacattcagttaccgagttgctatcgccaat
ggcctgcaaacagctgtgaccaacagtgatgaggacctgcttcaggagctgtcttccatt
gagagctcatactctgaatccttcaatgagctaaggagcagcactgaaaaccaggttcag
tcaacccacaccatgccggtcaggcgtaacaggaagagctcaagcagcttggcaccctcc
gagggcagctcagatggggagcgcaccctccacaccttaaaactgggtgctctacggaag
ctgaggaaatggaagaagagccaagagtgtgtctcctcagactcggagttgagcactgtg
aagaaaacctggggtataagaagcaaatctttagatagaactgctcggaacccaaagacc
aatgttttggagccagggttcagctcctctggctgtattagccaaacccatgatgtcatg
gaaatgatctttaaagagcttcagggtataagtcagattgaaacagaactttctgaactc
cgaggccatgtaaatgctctcaagtactctatcgatgaaatctccagcagtgtggaggtt
gtccagagtgagattgaacagcttcggacaggatttgtccaggctcgaagggaaactaga
gatatccacgattacattaaacacttgggtcacatggggagtaaagtaagcctgagattt
ttaaatgtgcctgaagaaagacatgaatatgtggaaagtgtggtgtaccaaattcttgta
gataaaatgggtttctctgatgtaccgaatgctattaaaattgaatttgctcagaggata
gggcaacaaagggattgcccaaacgcaaaacctcgacccatcctagtgtactttgaaacc
cctcagcaaagggattctgtcttaaagaaatcatacaagctcaaaggcacaggcattgcg
atctccacagatattctaacttatgatatcagagaacggaaagagaaaggggtattacca
tcttctcagacatatgaaagcatggatatgaagttatccacaccagagcccaaagccaag
aagaatgcttggctgtcacccaatgacagtgacagagagctggagtcagaccttagcaga
agcagctatgctgactctccagcaaagggaagttcttctaagtccagctcaaagtcacac
agcgctcggtctaagaacaaagcagctaacagcagaacgtcacagaagtcggactacaac
aaacggccatccaaaccgccagcatcagaaaagccaacacctcactatgtggaagccaca
ccactctggcattcacagagtgacttcttcactcctaaacttagtcgctctgaatcagat
ttttccaaattgtgtcagtcttactcagaggatttttctgaaagtcagtttttctgtaga
actaatgggagctccctcctttcctcttctgaccgagagctttggcagaggaaacaggag
ggtatgactgccttgtaccacagtcctcaggaccagggtttagatgggaatattcctaca
gtaccagggcagggtgaaattgagaatacagaaacagtggacagtggtatgagcaacagt
gtggtgtgtgcatctggagaccgaagcaattatagtggttcccagctctcactgcatgag
gacctgtctccatggaaggagtggaatcaagcagggcacggaactgatggtttagattca
tctacccaggaaccttttgactatgacaccaacagtttatctgaccaacagttggacatg
tctagcaaagacctagatgaccttggcaagtgccacagtgacctgcaagatgactcagag
agctatgatttaacccaggatgacaactcttctccatgccctggattggataatgaacca
caaggccagtgggttggccagtatgattcttatcagaaaaccaactctaatgacctgtac
cccaaccaaagccatccatccatgatgtatcgaagtcaaagtgaattgcaaagcgatgat
tccgaggcggcccagcccaagtcctggcacagtcggctaagcattgacctttctgacaag
acctttaagttccccaaatttggatccactcttcagagggcgaagtcagccctggaagtg
gtgtggaacaagagcacacagagtctcagtgggtgtgaggacagcggctcttccttaatg
gggagatttcggacattgtctcagtccacggcaaatgagtcaagtaccacccttgactct
gatatctacacagaaccctattactataaagctgaggaagaggaggactactgtgaacca
gtggctgacagtgagacggattatgttgaagtgatggagcaggtcctagctaagctagaa
aacaggactagtgtgactgaagtagatgaacacattaaagagtacgaccacccttcctat
gaaactccttatgagaccccacaagatgagggttatgatgggcaggctgatgacatcatt
agtgaaggagaactggaaaccttaaatgagccagcagttgaaatggaattagtagaagat
gaaagccaaaacctccctgtagagccaccagaggtcatgaagccaaagagaatccgacct
tccttcaaagaagcagctttaagggcttataagaagcagatggcagagctggaagagaag
atcctggctggagacagcagctccgtggatgaaaaggctcgaatagtaagtggcaacgat
ttggatgcttccaaattctccgcactccaggtgttcggtggggctgggcgtggactttac
ggaatagacagcatgcctgatctccgcaggaaaaagacactgcctattgtacgggatgtg
gccatgaccctggctgcccggaaatctggtctatcccttgctatggttatcaggacatcc
ctgaacaatgaggagctgaaaatgcatgtcttccggaagaccttgcaggcattgatctac
cccatttcttctaccactcctcacaacttcgaggtctggacagctaccacacccacctac
tgctatgagtgtgaagggctgctgtggggcattgcaaggcaaggcatgaagtgtctggag
tgtggggtgaaatgtcacgagaagtgtcaggacctgctcaacgccgactgtctgcagcga
gcagcggagaagagctctaagcatggtgcagaggacaagacgcagaccatcatcacagcc
atgaaagaaagaatgaagatcagggagaggaacaggccagaggtgtttgaagtcattcag
gaaatgttccagatctccaaagaggattttgtgcagtacacaaaggctgccaagcagagc
gtgctagatggcacgtccaagtggtcagcgaaaataaccatcacagtggtttctgcacaa
ggcttgcaggcaaaagacaaaacagggtccagtgacccatatgtgacagttcaagttggc
aagaataaaagaagaacgaaaactatctttggaaacttgaatccggtgtgggatgagaag
ttctactttgagtgtcataactcgacagaccgaatcaaggtcagagtgtgggatgaagac
gacgacattaaatccagagtgaagcaacacttcaagaaggagtcagatgactttctggga
cagacgattgtcgaagtcaggactctgagtggcgagatggatgtctggtacaacttagag
aaacggacagataaatcagctgtgtctggggccatccgactaaaaatcaatgtggaaata
aagggagaggagaaggttgcaccgtatcatatacaatacacttgtttacacgagaacctg
ttccattacctgacagaagtgaagtctaatggcagcgtgaaaataccagaggtcaaaggc
gatgaagcctggaaggttttctttgatgatgcttctcaagaaatagtggatgaatttgcc
atgcgttatggggttgagtccatttatcaagctatgacgcacttttcatgtctgtcttct
aagtacatgtgcccgggtgtccctgcagtcatgagcgccctgctggcgaacatcaatgcc
ttctatgctcatacaactgtctccactaacgtgcaggtttctgcttctgatcgctttgct
gctacgaactttgggagggaaaaattcataaaactactggaccagttgcataactcctta
aggattgatctgtcaaaatacagggaaaactttccagccagcaacagtgagagactacag
gacctaaagtccactgtggacctgctgaccagcatcaccttcttccggatgaaggtcctg
gagctgcagagccccccaaaggccagcgcagtggtgaaggattgtgtcagggcttgtctg
gattccacgtacaagtatatcttcgacaactgccacgaactctattctcagctgatagac
ccgagcaagaagcaggatgttcctcgggaagagcagggaccaaccaccaagaacctggac
ttctggccacagttgattacactgatggtcactatcattgatgaggataagactgcctac
acccctgttctcaatcagttcccacaagaactaaacatggggaagataagtgcagaaatc
atgtggtctctctttgctctcgatatgaaatatgctctagaggaacatgagaagcagcgc
ttatgcaagagcaccgattatatgaatttgcatttcaaagtgaaatggttttataatgag
tatgtacgagaacttcctgccttcaaggatgctgttccagaatattccctgtggtttgag
ccttttgttatgcaatggctagatgaaaatgaagatgtgtccatggaattccttcatgga
gcactgggaagagacaaaaaggatggattccagcagacatcggaccatgccctcttctcc
tgttctgtggttgatgtctttgctcagcttaaccagagctttgagatcattaagaaactg
gaatgccccaatcctgaagccttatcacacttaatgagacgattcgcaaagaccatcaat
aaggttctggtccaatacgctgcgatcgtatcaagtgacttcagttcatactgtgataag
gagacagtgccttgcatattgatgaacaacatccaacaactgcgggtccagctggaaaag
atgttcgaatccatgggtgggaaagagctagaccccgaagctagcactattctgaaagaa
cttcaaatcaaactcaacggggttctggatgcgctcagcgtcacttatggagaaagtttc
caacttgtaattgaagagtgcataaagcagatgggtgccgagctaaatcagatgcgagca
aacggaaacagcgcagccaataagaacaacgcagcgatggatgcggagattgtgctgagg
ccgctcatggacttcttggataagatattaagtctttcagcaaaaatctgtgagaaaacg
gtcctgaagcgagttctgaaggagctctggaaattagttcttaacaagatagagaaacag
attgttctccctccactgacagaccagacaggacctcagatgatcttcattgcagctaaa
gagcttggacagttatccaaactgaaggagcacatgatccgagatgatgccaagggtctg
acaccaagacaatgtgcaataatggaggtggtcctggccactataaagcaatactttcat
gcaggaggaaatggcctgaagaagaattttctggagaaaagcccagatcttcattccctg
agatacgctctcagcctctacacacaaaccactgatgctttgatcaagaagttcatcgag
acccagggctcacagagtcgttcctccaaagatgctgtaggccagatctctgtccatgtg
gatgtcaccaccaccccagggactggagagcataaagtcactgtaaaagtgattgcgatc
aatgacctaaactggcagaccaccaccatgttccgcccctttgtggaagtgtgcatgctg
ggacccagcctgggagacaagaagagaaaacaagggacaaagacaaaaagtaacacgtgg
tcaccgaagtacaatgaaaccttccagttcattctgggtaatgagaaccgcccaggagcc
tatgaacttcacctctcagttaaggactactgctttgcccgagaagatcgaataattgga
atgacagtcattcagttacagaatatagcagagaaagggagctacggggcatggtaccct
ctcctgaaaaatctctctatggatgaaactggtttaaccatccttcgaatactctctcag
agaaccagtgacgatgtcgctaaagagtttgtgagacttaagtctgaaacgaggtctatt
gacgagagtgcctga

KEGG   Rattus norvegicus (rat): 64829
Entry
64829             CDS       T01003                                 

Gene name
Unc13a
Definition
(RefSeq) protein unc-13 homolog A
  KO
K15293  protein unc-13 A/B/C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    64829 (Unc13a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64829 (Unc13a)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    64829 (Unc13a)
SSDB
Motif
Pfam: MUN C2 C1_1
Other DBs
NCBI-GeneID: 64829
NCBI-ProteinID: NP_074052
RGD: 619722
Ensembl: ENSRNOG00000018452
UniProt: Q62768
Structure
PDB: 

Position
16
AA seq 1735 aa
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQAIMADSEICGTKDPTFHR
ILLDAHFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDQQDKPLPVPSSQCCNWNYF
GWGEQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYSD
SMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSELDDERDRDSY
HSCHSSVSYHKDSPRWDQDEEDLEDLEDLEDEELPEEEELEEEELEEEEELEEEELELEE
EEEVPDDLASYTQQEDTTVAEPKEFKRISFPTAAPQKEDKVSAVPIEAPDVSKGIPKAAT
PEEKAAAECAQEAEPPKSEESFRSREAEEGQEGQDAMSRAKANWLRAFNKVRMQLQEARG
EGEMSKSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTL
NNEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTEC
GVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQE
VFAVTKSAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGK
TKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVLDEDDDIKSRVKQRFKRESDDFLGQ
TIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLF
HFVTDVQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSK
YMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRID
LSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNST
YEYIFNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYT
PCLNQFPQELNVGKISAEVMWSLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEY
VAELPTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSC
SVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKE
KEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATS
FQPHIEECVRQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICE
KTVLKRVLKELWKLVMNTMERTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQ
MIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEK
SPDLQSLRYALSLYTQATDLLIKTFVQTQSAQVHGGKGTRFTLSEDVCPEMGSGVEDPVG
EVSVHVELFTHPGTGEQKVTVKVVAANDLKWQTSGIFRPFIEVNIVGPQLSDKKRKFATK
SKNNSWAPKYNESFQFSLSADAGPECYELQVCVKDYCFAREDRTVELAVLQLRELAQRGS
AACWLPLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
NT seq 5208 nt   +upstreamnt  +downstreamnt
atgtctctgctgtgcgtgggagtcaaaaaagccaagtttgacggtgcccaagagaagttc
aacacatacgtgacgctgaaggtgcagaacgtgaagagcactaccatagctgtacgcggc
agccagcctagctgggagcaggacttcatgtttgagatcaaccgcctggatctgggcctg
acggtggaggtgtggaacaagggtctcatctgggacacaatggtgggtactgtgtggatc
ccacttcggaccatccgtcagtccaatgaggagggtccgggagaatggctgacactggac
tctcaggccatcatggcggacagtgagatctgtgggaccaaggaccccaccttccaccgc
atcctcctggacgcacattttgagctgcctttggacatccccgaggaggaggcgcgctac
tgggccaagaagctggagcagctgaatgccatgcgtgaccaagatgagtactcctttcag
gaccagcaggacaagccactgccggtgcccagcagccagtgctgcaactggaattacttt
ggctggggagaacagaatgatgatcccgacagtgccgtggatgaccgggacagtgattat
aggagtgagacgagcaacagcatcccaccgccttactacacgacttcgcagcccaatgct
tcggtgcaccagtactccgtgcggccaccccctctggggtcccgggagtcctacagcgac
tccatgcacagctatgaagagttctctgagccgcgggcactcagtcccacaggcagcagc
cgctatgcttccagtggggagctgagccagggcagctcccagctgagtgaggacttcgac
ccggatgagcacagcctacagggctcagagctggatgacgagagggaccgagattcttat
cactcctgccacagctctgtgagctaccacaaggactcaccccgctgggaccaggatgag
gaggacctggaggacctggaggacctggaagatgaggagttgcccgaggaagaggagttg
gaagaggaggagttggaggaggaggaggagttggaggaagaggaattggagttggaggag
gaggaggaggtgcctgatgacctggccagctatacccagcaggaggacaccactgtggct
gagcccaaagagttcaagcggatcagcttcccaacagctgcacctcagaaggaagacaaa
gtttcagctgtgcccattgaggcccccgatgtgtccaaaggcatccccaaggcagccaca
cctgaagagaaggcagctgcggagtgtgcacaggaagcggagccccccaagtctgaggag
agtttcagatctcgagaggctgaggagggccaggaagggcaggatgccatgtccagggcc
aaagccaactggttgcgagccttcaacaaggtgcgcatgcagctgcaggaggcccgagga
gaaggagagatgtccaagtctctgtggttcaaaggcggccctggtggtggccttatcatc
attgacagcatgccagacatcaggaagcggaagcccattcccctcgtgagcgacctggct
atgtctctggtccagtcacggaaggcgggcatcacctcggccttggcctccagcacgttg
aacaatgaagagttgaaaaaccacgtttacaagaagaccctgcaagccttaatctacccc
atctcctgcaccacgccgcacaacttcgaggtgtggacggccaccactcccacctactgc
tacgagtgcgaggggctgctgtggggcatcgcgcggcagggcatgcgctgcaccgagtgc
ggcgttaagtgccacgagaagtgccaagacctgctcaacgcggactgcctgcagcgggcg
gctgagaagagttctaagcatggcgctgaagaccgcacgcagaacatcatcatggtgctg
aaggaccgcatgaagatccgcgagcgcaacaagcctgagatcttcgagctgatccaggag
gtcttcgcggtcaccaagagcgcacacacacagcagatgaaggccgtcaagcagagtgtg
ctggatggcacatccaagtggtctgccaaaattagcatcacggtggtctgtgcccagggc
ttgcaggccaaggacaagacaggatccagtgacccttatgtcaccgtccaggttgggaag
accaagaaaaggacaaaaaccatctacgggaaccttaacccagtgtgggaagagaatttc
cactttgaatgtcacaactcctctgaccggatcaaggtgcgtgtgttggatgaagacgat
gacatcaaatcccgtgtgaagcaaaggtttaagagggagtctgatgacttcctagggcag
acaatcatcgaggtgcggacgcttagcggcgagatggatgtgtggtacaatctggacaag
agaacagacaagtctgctgtgtcgggcgccattcggcttcacatcagtgtggagatcaaa
ggggaggagaaggtggcaccctaccatgtccagtacacctgtctgcatgagaacctgttc
cattttgtgacggatgtacagaacaatggcgtggtgaagattcccgatgccaaaggtgac
gacgcctggaaggtttactatgatgagactgcccaggagatcgtggatgagtttgccatg
cgctatggcgttgaatccatctaccaagccatgacccactttgcctgcctctcctccaag
tacatgtgccctggggtacccgctgtcatgagcaccctgcttgccaacatcaacgcctac
tacgcacacaccaccgcctccaccaacgtgtctgcctccgaccgcttcgctgcctccaat
ttcgggaaagagcgctttgtgaaacttctggaccagctgcacaactccctgcggattgac
ctgtccatgtaccggaacaacttcccggccagcagccccgagcggctgcaggatctcaag
tccacagtggacctgcttaccagcatcaccttcttccggatgaaggttcaggaactgcag
agtccgccacgtgccagtcaggtggtgaaggactgcgtgaaggcgtgcctcaactccacc
tacgagtacatcttcaacaactgtcatgagctctatggccgggagtaccagacagacccg
gccaagaagggggaggtccccccggaggagcaaggccctagcatcaagaacctggatttc
tggtccaagctcatcaccctcatcgtgtctatcattgaggaggataagaactcctacaca
ccctgcctcaatcagtttccccaggagctgaatgtggggaagatcagtgctgaggtgatg
tggagcctgtttgcccaggacatgaagtacgccatggaggaacacgacaagcaccggctg
tgtaagagcgcagactacatgaacctgcatttcaaggtcaagtggttgtacaacgagtac
gtggctgaactgcccaccttcaaggaccgcgtgccggagtaccctgcgtggtttgagccc
ttcgtcatccagtggttagatgagaatgaggaggtgtcccgggacttcctgcatggtgca
ctcgagcgggacaagaaggatgggttccagcagacatcggagcacgccctgttctcttgc
tcggtagtggacgtcttctcccagctcaaccagagctttgagatcatcaagaagctggag
tgtcctgacccccagattgtgggccactacatgcggcgctttgccaagaccattagcaat
gtgcttctccagtacgccgacatcgtctccaaggacttcgcttcctactgctccaaggag
aaggagaaagtgccctgcatcctcatgaacaacacacagcagctgcgggtgcagctggag
aagatgttcgaggcgatgggtgggaaggagctggacgccgaggccagcggaaccctgaag
gagctgcaggtgaaactcaacaatgtcctggatgaactcagccacgtgtttgccaccagc
ttccagccacacatcgaggagtgtgtcagacaaatgggtgacatcctaagccaagtgaag
ggcacgggcaacgtgcccgccagtgcctgcagcagcgtggcacaggacgcagacaacgtg
ctacagcccatcatggatcttctggacagcaacctcaccctgtttgccaaaatctgtgag
aagacggttctgaagcgggtgctgaaggagctgtggaagctggtgatgaacaccatggag
aggaccattgtcctgccgccactcactgaccagacgatgattggtaccctcttgagaaaa
catggcaagggcctagaaaagggcagggtgaaactgccaagccactcagacgggacacaa
atgatcttcaatgccgccaaggagctgggccagctgtccaaactgaaggatcacatggtg
cgagaagaagccaagagcttgaccccgaagcagtgtgccgtggttgaactggccctggac
accatcaagcaatacttccacgcggggggcgtgggcctcaagaagacctttctcgagaaa
agcccggaccttcagtccctgcgctacgccctgtcgctctacacacaggccaccgacctg
ctcatcaaaaccttcgtgcagacgcagtcagcgcaggtccatggtggaaaggggactagg
tttacccttagtgaagacgtttgtcctgagatgggctcgggtgtggaagaccctgtaggt
gaagtatccgtccacgtggagctgttcacgcatccgggaactggggaacagaaggtcaca
gtgaaggtggtggccgccaacgacctcaagtggcagacttctggcatcttccgtccgttc
attgaggtcaacatcgttggacctcagctcagcgacaagaaacgaaagttcgccaccaaa
tcgaaaaacaacagctgggcgcccaaatataacgagagcttccagttctccctgagcgcc
gacgcgggacccgagtgctacgagttgcaggtgtgcgtgaaggactactgcttcgcgcgc
gaggaccgcacggtggagctggcggtgctgcagctgcgggagctggctcagcgcgggagc
gccgcgtgctggctgccgctcggccgccgcatccacatggacgacacggggctcacagtg
ctgcgtatcctgtcgcagcgcagcaatgacgaggtggccaaggagttcgtcaagctcaag
tccgacacgcgctcggccgaggagggcggtgccgcgcctgcgccctag

KEGG   Rattus norvegicus (rat): 64830
Entry
64830             CDS       T01003                                 

Gene name
Unc13b
Definition
(RefSeq) protein unc-13 homolog B isoform u
  KO
K15293  protein unc-13 A/B/C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    64830 (Unc13b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64830 (Unc13b)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    64830 (Unc13b)
SSDB
Motif
Pfam: MUN C2 C1_1
Other DBs
NCBI-GeneID: 64830
NCBI-ProteinID: NP_001036044
RGD: 619723
Ensembl: ENSRNOG00000008237
UniProt: Q62769
Position
5
AA seq 1622 aa
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKNDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTYKLEQINALADDNEYSSQEESQRKLLPTAAAQCCHWTY
LGWGEHQTFEDPDSAVDDRDSDYRSETSNSAPPPYHTTTQPNASAHQFPMPVPLPQQLFL
QGSSRDSCNDSMQSYDLDYPERRALSPTSSSRYGSSCNVSRGSSLLSELDQYHEQDDDGR
ERDSIHSSHSYGSLSRDGQAGLGEQEKALEVACESQKEKTGESKERDDATVCPPSDLMLH
KDLTLGPQESFPEEKASSPFTQARAHWFRAVTKVRLQLQEISDDGDPSLPQWLPEGPAGG
LYGIDSMPDLRRKKPLPLVSDLAMSLVQSRKAGITSAMATRTSLKDEDLKSHVYKKTLQA
LIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADC
LQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTV
KQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVW
EEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWY
NLEKRTDKSAVSGAIRLQINVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVWIPD
ARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLAN
INAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERL
QDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQY
QLQEQPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMW
HLFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVRELPALQGQVPEYPAWFEQF
VLQWLDENEDVSLEFLRGALERDKRDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLEC
PDPSILAHYMRRFAKTIGKVLIQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMF
EAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTG
NASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVI
VLPPLIDQTGTQLILTAAKELSQLSKLKDHMVREETRNLTPKQCAVLDLALDTVKQYFHA
GGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFTANEDIR
PEKGAGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGP
HQSDKKRKFTTKSKSNSWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLA
VMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRSIEE
GS
NT seq 4869 nt   +upstreamnt  +downstreamnt
atgtcgctgctctgcgtgcgtgttaagagagccaaattccagggttcaccagataagttt
aacacatacgtgaccctgaaagtccagaacgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggagcaagatttcatgtttgagatcagccgtctggacctgggccta
agtgtggaggtgtggaacaaagggctgatatgggacacaatggtggggaccgtgtggatc
gcactgaagactatccgccagtcggatgaggaagggcctggggagtggtctacactggag
gctgagacattaatgaaaaatgatgagatctgtggaactaaaaacccaactcctcataaa
atcttgcttgatacacgatttgagctgccttttgacatcccagaggaggaagccagatat
tggacctacaaattggaacaaataaatgccttggcagatgataatgagtattccagtcaa
gaagaaagccagaggaagctgttgcccactgctgccgcccagtgttgtcactggacctat
ttgggctggggagagcatcagacctttgaagaccctgatagtgccgttgatgaccgggac
agtgactatcgaagtgagaccagcaatagtgccccacctccttatcacacgactacccag
cccaacgcgtctgcacaccagttccctatgccagtgccactgccacagcagctatttctt
cagggaagttcccgagactcctgcaatgactctatgcagagttatgaccttgattaccca
gagcgtcgggccctcagccccactagcagtagtaggtatggctcctcctgtaatgtgagt
cgaggaagctctctgctgagtgaactggaccagtatcatgagcaagacgatgatggtcgg
gagagggactccattcattctagccatagctatggcagcctctccagagatggccaggct
ggcttgggagaacaagagaaagccttggaagtggcctgtgaatcacagaaggagaaaaca
ggtgaatccaaggagagagatgatgccacagtctgccctccgtcagacctgatgctgcac
aaggacctcaccctaggaccccaggagagttttcccgaggagaaagcatcgtcgcccttt
acccaggccagagcacactggttccgagcggttaccaaggtccgactccagctgcaggag
atttcagatgatggtgacccctccttgcctcagtggctcccagaagggccagcgggaggg
ctctatggcatcgacagcatgccagatctacgaagaaagaagccactgccacttgtcagt
gatctggctatgtcactggtccagtcacggaaagcagggattacttccgctatggctaca
cgtacctctctcaaggatgaagatctgaaatcccatgtgtataagaaaactctgcaggcc
ttaatctaccccatctcgtgcaccacgccccacaactttgaggtctggtctgccacgaca
cccacctactgctatgagtgtgaaggcttgctctggggccttgcccggcaaggcatgcgc
tgcagcgagtgtggcgtcaagtgccatgagaagtgccaagacctgctcaatgccgattgc
ctacagcgggccgctgaaaagagctctaagcacggagctgaggaccggactcagaacatt
atcatggccatgaaggaccgtatgaagatccgagaacggaataaaccagagatctttgag
gttatccgggatgtgttcacagtgagcaaagttgcccacgtgcagcagatgaaaacagta
aagcagagtgtcctggatggcacctccaagtggtcggccaaaattaccatcacggtggtt
tgtgcccagggcctacaagccaaagacaagacaggatccagtgacccttatgtgactgtg
caagttgggaaaaccaagaagcgcactaagaccatttttggaaatttgaatcctgtttgg
gaggagaagttccattttgagtgccacaactcttccgatcgaattaaggtacgtgtgtgg
gatgaggatgatgacatcaaatccagagtaaagcagcggctgaagcgagagtcggatgat
ttccttggccaaactatcattgaagttcgaacgctgagtggagagatggatgtctggtat
aatctggagaagagaacagacaagtcagctgtctcaggggctatccgactgcaaatcaat
gtggagatcaagggggaggagaaggtagccccataccatgtgcaatacacatgtctccat
gagaatcttttccattacctcacagacattcagggcagtggaggagtctggatcccagac
gctcggggggacgatgcatggaaggtgtactttgacgagacagcccaagaaattgtggat
gaatttgccatgcgctatggcatcgagtccatatatcaggccatgacgcactttgcgtgt
ttgtcatccaagtacatgtgtcctggcgtaccagccgtgatgagtaccttactggccaac
atcaatgcgtattatgctcacacaaccgcctccactaacgtctctgcatctgaccgcttt
gccgcctccaactttggtaaagaaagatttgtaaaactgctggaccagctacacaactca
ctgaggatagacctgtctacatacaggaataactttcctgctgggagccctgagcggctc
caggatttaaaatctacagtggacttgctgaccagcattactttcttcaggatgaaggtg
caagaacttcagagccccccaagagccagccaggtggtaaaggactgtgtgaaggcctgc
ttgaactctacatatgaatacatcttcaacaactgccatgacctctacagtcaccaatac
cagctgcaggaacaaccactagaggaaccagggcccagcattcggaacttggatttctgg
cccaaacttatcacactgattgtgtcaatcatagaggaggataagaattcctacacacct
gttctgaaccagtttcctcaggagttgaatgtaggaaaagtcagtgcagaagtgatgtgg
cacctgtttgctcaagacatgaaatatgcactggaggaacatgagaaagaccggctgtgt
aagagtgctgactacatgaacctgcacttcaaggtgaagtggctccacaatgaatatgtg
cgggagctgcctgccctccaggggcaggtgcctgagtacccagcgtggtttgagcagttc
gtgctacagtggctagatgaaaatgaagacgtgtccctggaattccttcgtggggccttg
gaacgagataagagagatgggttccagcaaacatcggagcatgccttgttttcctgttct
gtggtggacgtctttacacaactcaaccagagctttgagatcatccggaaattggaatgt
ccagaccccagcatccttgcccattatatgagaaggtttgctaagaccatcggcaaagtg
ctgatacagtatgcagacatcttatcaaagaacttcccagcttactgcacaaaggagaga
ctgccctgtatcctgatgaacaacatgcagcaactgagggtccagctggagaaaatgttt
gaggccatgggaggcaaagagctggactctgaagctgcagacagtctgaaggagctgcag
gtgaaactgaatacagttctggatgagctcagcatggtgtttggaaacagcttccaggtg
cggatcgacgagtgtgttcgacaaatggctgacatcctgggccaagtacggggcacaggg
aatgcatcccctaacgccagagcctcggtggctcaggatgcagatagtgtgctgcgacct
ctcatggatttcctggatggcaacctcacactgtttgccactgtgtgtgagaagacagtg
ctgaagcgagtcctgaaggagctctggcgagtggtgatgaacaccatggagcgggtcatc
gtcctgcccccactcattgaccagacaggcacccagctgatcttaactgctgccaaggag
ctgagccagctttccaaactcaaggaccacatggtacgagaggaaacacggaatctcact
ccaaagcagtgtgctgtcctcgacttggccttggacaccgtcaagcaatacttccatgca
ggaggcaatggtctgaagaaaaccttcctggaaaagagcccagacctgcagtctctacgt
tatgccctctctctgtatacacagaccacagacactctcatcaagacatttgtgcgctca
cagactgcccaggtacatgatgggaaaggtattaggtttactgctaacgaggacattcgg
ccagaaaagggggctggtgtggacgaccctgtgggagaagtctctattcaggtggacttg
tttacacatcctggcactggggagcataaggtcacagtgaaagtggtagcagccaatgat
ctcaagtggcagacagcaggtatgttccggccttttgtggaagtgaccatggttggccca
caccaaagcgataagaagaggaagttcacaaccaagtctaaaagtaacagctggactccc
aagtacaacgagacttttcatttcctcctgggaaatgaagagggtcccgaggcctatgaa
ttgcagatatgcgtgaaggattactgctttgcccgggaggatcgtgtgataggactggca
gtgatgcccctgagggatgtggcagctaagggcagctgtgcctgctggtgcccgttgggc
cggaagatccacatggatgagacaggcatgaccattctccggattctgtctcagaggagc
aatgatgaggtagcccgagagttcgtgaagctcaagtcagagtctcgatccatagaggaa
gggagctga

DBGET integrated database retrieval system