KEGG   Rattus norvegicus (rat): 286934Help
Entry
286934            CDS       T01003                                 

Gene name
Havcr1, KIM-1, Kim1
Definition
(RefSeq) hepatitis A virus cellular receptor 1
  KO
K20413  hepatitis A virus cellular receptor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    286934 (Havcr1)
CD molecules [BR:rno04090]
 Proteins
  286934 (Havcr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set I-set Receptor_2B4 Ig_2 Ig_6 FAM217
Motif
Other DBs
NCBI-GeneID: 286934
NCBI-ProteinID: NP_775172
RGD: 708425
Ensembl: ENSRNOG00000007243
UniProt: O54947
Position
10q21
AA seq 307 aa AA seqDB search
MVQLQVFISGLLLLLPGSVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSC
QNILIWTNGYQVTYRSSGRYNIKGRISEGDVSLTIENSVDSDSGLYCCRVEIPGWFNDQK
MTFSLEVKPEIPTSPPTRPTTTRPTTTRPTTISTRSTHVPTSTRVSTSTPTPEQTQTHKP
EITTFYAHETTAEVTETPSYTPADWNGTVTSSEEAWNNHTVRIPLRKPQRNPTKGFYVGM
SVAALLLLLLASTVVVTRYIIIRKKMGSLSFVAFHVSKSRALQNAAIVHPRAEDNIYIIE
DRSRGAE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacttcaagtcttcatttcaggcctcctgctgcttcttccaggctctgtagat
tcttatgaagtagtgaagggggtggtgggtcaccctgtcacaattccatgtacttactca
acacgtggaggaatcacaacgacatgttggggccgggggcaatgcccatattctagttgt
caaaatatacttatttggaccaatggataccaagtcacctatcggagcagcggtcgatac
aacataaaggggcgtatttcagaaggagacgtatccttgacaatagagaactctgttgat
agtgatagtggtctgtattgttgccgagtggagattcctggatggttcaacgatcagaaa
atgaccttttcattggaagttaaaccagaaattcccacaagtcctccaacaagacccaca
actacaagacccacaaccacaaggcccacaactatttcaacaagatccacacatgtacca
acatcaaccagagtctccacctctactccaacaccagaacaaacacagactcacaaacca
gaaatcactacattttatgcccatgagacaactgctgaggtgacagaaactccatcatat
actcctgcagactggaatggcactgtgacatcctcagaggaggcctggaataatcacact
gtaagaatccctttgaggaagccgcagagaaacccgactaagggcttctatgttggcatg
tccgttgcagccctgctgctgctgctgcttgcgagcaccgtggttgtcaccaggtacatc
attataagaaagaagatgggctctctgagctttgttgccttccatgtctctaagagtaga
gctttgcagaacgcagcgattgtgcatccccgagctgaagacaacatctacattattgaa
gatagatctcgaggtgcagaatga

DBGET integrated database retrieval system