KEGG   Rattus norvegicus (rat): 286938Help
Entry
286938            CDS       T01003                                 

Gene name
Gimap4, Ian1
Definition
(RefSeq) GTPase, IMAP family member 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: AIG1 MMR_HSR1 FeoB_N RsgA_GTPase Dynamin_N HAUS6_N
Motif
Other DBs
NCBI-GeneID: 286938
NCBI-ProteinID: NP_775176
RGD: 628765
Ensembl: ENSRNOG00000008369
UniProt: Q8K3K9 Q6IRE3
Position
4q24
AA seq 310 aa AA seqDB search
MEAQYSGVGSIPENSRSSHELGIQDQGSPQLRIVLLGKTGAGKSSTGNSILGRKAFLSGI
CAKSITKVCEKGVSIWDGKELVVVDTPGIFDTEVPDADTQKEITRCVALTSPGPHALLLV
IPLGRYTVEEHKATRKLLSMFEKKARRFMILLLTRKDDLEDTDIHEYLETAPEVLQELIY
EFRNRYCLFNNKASGAEQEEQKRQLLTLVQSMVRENGGKYFTNKMYESAEGVIQKQTWKK
KEFYREELERERARIRREYEAEIQDLRDELERERRRARMEREFNENELIFAERQQNARRE
VENTSMIYLN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccagtacagtggtgtggggtccatcccggaaaattcaaggagcagccatgag
cttggaatacaagatcaaggaagtccccaactgagaattgtcctacttggaaaaactgga
gcaggaaagagttcaacagggaacagcatccttggaagaaaagcatttctttctggcatt
tgtgcaaaatccattaccaaggtctgtgagaaaggagtgagcatctgggatgggaaagag
ctcgttgttgtggatacacctggcattttcgacactgaggtaccagatgctgacacacaa
aaggagatcactcgctgtgttgctctgacctctccagggcctcatgctctgcttctggtc
atcccactggggcgttatactgtggaagaacacaaggccacacggaaacttctgagcatg
tttgaaaaaaaggctagaagattcatgatactcttgctcaccaggaaggatgacttggaa
gacacagatatccatgagtacttagagacggctcctgaagtccttcaagagttgatctat
gagttccggaatcgctactgtttgttcaataacaaagcatcaggagctgaacaggaagag
cagaagaggcagctgttgaccttagttcagagcatggtgagggaaaatggtggaaaatac
tttactaacaagatgtatgaaagtgctgagggtgtgattcagaaacaaacctggaagaag
aaagaattttacagagaggaactggagagagagagagcacggataagacgggagtatgaa
gcagagattcaagatctgagagatgagctggaaagggaaaggagaagggcacgtatggag
agggagttcaatgagaacgagcttatctttgcagagagacaacaaaatgctaggagggaa
gttgagaacacaagtatgatatacttgaattaa

DBGET integrated database retrieval system