KEGG   Rattus norvegicus (rat): 286954
Entry
286954            CDS       T01003                                 

Gene name
Ugt2b1, 2B1, Udpgtr2, Ugt2b17
Definition
(RefSeq) UDP glucuronosyltransferase 2 family, polypeptide B1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
rno04976  Bile secretion
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    286954 (Ugt2b1)
   00053 Ascorbate and aldarate metabolism
    286954 (Ugt2b1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    286954 (Ugt2b1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    286954 (Ugt2b1)
   00860 Porphyrin and chlorophyll metabolism
    286954 (Ugt2b1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    286954 (Ugt2b1)
   00982 Drug metabolism - cytochrome P450
    286954 (Ugt2b1)
   00983 Drug metabolism - other enzymes
    286954 (Ugt2b1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    286954 (Ugt2b1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    286954 (Ugt2b1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    286954 (Ugt2b1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     286954 (Ugt2b1)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   286954 (Ugt2b1)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pro_3_hydrox_C
Other DBs
NCBI-GeneID: 286954
NCBI-ProteinID: NP_775417
RGD: 708541
Ensembl: ENSRNOG00000001990
Vega: OTTRNOG00000000152
UniProt: P09875
Position
14p21
AA seq 529 aa
MSMKQTSVFLLIQLICYFRPGACGKVLVWPTEYSHWINIKIILNELAQRGHEVTVLVSSA
SILIEPTKESSINFEIYSVPLSKSDLEYSFAKWIDEWTRDFETLSIWTYYSKMQKVFNEY
SDVVENLCKALIWNKSLMKKLQGSQFDVILADAVGPCGELLAELLKTPLVYSLRFCPGYR
CEKFSGGLPLPPSYVPVVLSELSDRMTFVERVKNMLQMLYFDFWFQPFKEKSWSQFYSDV
LGRPTTLTEMMGKADIWLIRTFWDLEFPHPFLPNFDFVGGLHCKPAKPLPREMEEFVQSS
GEHGVVVFSLGSMVKNLTEEKANVVASALAQIPQKVVWRFDGKKPDTLGSNTRLYKWIPQ
NDLLGHPKTKAFVAHGGTNGIYEAIYHGIPIVGIPLFADQPDNINHMVAKGAAVRVDFSI
LSTTGLLTALKIVMNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEYVMRHKGAKHLRST
LHDLSWFQYHSLDVIGFLLLCVVGVVFIITKFCLFCCRKTANMGKKKKE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgtctatgaaacagacttcagtgtttctgttgatacagctcatatgctactttagacct
ggagcctgtggaaaagtgctagtgtggcccacagaatacagccactggattaatataaag
ataattctgaatgaacttgcccagagaggtcatgaagtcacggttcttgtatcttcggct
tccattctcattgagcctaccaaggaatcttctattaattttgagatttactctgtacct
ttgagtaaaagtgatcttgaatatagttttgcaaaatggatagatgaatggacacgtgat
tttgaaacactctcgatttggacatattattcaaaaatgcaaaaagtcttcaatgaatat
tctgatgtcgttgaaaatttatgcaaagcactcatttggaacaagagtcttatgaaaaaa
ctccaaggatctcaatttgatgtcattctcgcagatgctgtgggtccctgtggtgagctg
ctagcagaactgcttaagacacctttagtgtacagtctccgcttctgtcctggatacaga
tgtgaaaagttcagtgggggacttccactgcctccttcctatgtgcctgttgttctttca
gaattaagtgaccgcatgacatttgtggaaagagtgaagaatatgttgcagatgctgtat
tttgacttttggtttcaaccatttaaagagaagtcctggagtcagttttacagtgatgtt
ctaggtagacccacaacattaactgagatgatggggaaggcagatatatggctcattcga
accttctgggacttggaatttccacacccattcttacctaattttgactttgttggagga
ctacattgcaaaccagccaaaccactgcctagggaaatggaagaatttgttcagagctct
ggagaacatggtgtagtggtgttttctctgggatcaatggttaaaaacctgactgaagaa
aaagccaatgtagttgcttctgctcttgcccaaattccacagaaggttgtatggagattt
gatggtaagaaaccagataccttaggatctaacactcggctgtacaagtggatcccccag
aatgaccttcttggtcatccaaaaaccaaagcttttgtagctcatggtggaacaaatggc
atctatgaggcaatctaccatggcattcctattgttggtattcccttgtttgcagatcaa
ccggataacattaatcacatggtagccaaaggagctgctgttagagttgacttcagcata
ctgtcaactacaggccttctcactgccttgaagattgtcatgaatgacccttcctataag
gagaatgccatgagattatccagaatccaccatgatcagccagtgaagcccctggaccga
gccgtcttctggatcgagtatgtcatgcgtcacaaaggagccaagcacctccgctcaact
ctgcatgaccttagctggttccagtaccactctctggatgtcattgggttcctattgctc
tgtgtggtaggtgtggtattcatcatcacaaaattctgcctcttttgttgccgtaagact
gctaacatgggaaagaagaagaaagagtag

DBGET integrated database retrieval system