KEGG   Rattus norvegicus (rat): 286963
Entry
286963            CDS       T01003                                 

Gene name
Cyp2d5, Cyp2d10
Definition
(RefSeq) cytochrome P450, family 2, subfamily d, polypeptide 5
  KO
K07414  cytochrome P450 family 2 subfamily D [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    286963 (Cyp2d5)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    286963 (Cyp2d5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    286963 (Cyp2d5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     286963 (Cyp2d5)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   286963 (Cyp2d5)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 286963
NCBI-ProteinID: NP_775426
RGD: 628630
Ensembl: ENSRNOG00000029128
UniProt: P12939
Position
7q34
AA seq 504 aa
MELLNGTGLWPMAIFTVIFILLVDLMHRHQRWTSRYPPGPVPWPVLGNLLQVDPSNMPYS
MYKLQHRYGDVFSLQMGWKPMVIVNRLKAVQEVLVTHGEDTADRPPVPIFKCLGVKPRSQ
GVVFASYGPEWREQRRFSVSTLRTFGMGKKSLEEWVTKEAGHLCDAFTAQNGRSINPKAM
LNKALCNVIASLIFARRFEYEDPYLIRMLTLVEESLIEVSGFIPEVLNTFPALLRIPGLA
DKVFQGQKTFMAFLDNLLAENRTTWDPAQPPRNLTDAFLAEVEKAKGNPESSFNDENLRM
VVVDLFTAGMVTTATTLTWALLLMILYPDVQRRVQQEIDEVIGQVRCPEMTDQAHMPYTN
AVIHEVQRFGDIAPLNLPRITSCDIEVQDFVIPKGTTLIINLSSVLKDETVWEKPLRFHP
EHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQHFSFSVPAGQPRPST
LGNFAISVAPLPYQLCAAVREQGH
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggagctgctgaatgggactggcctgtggcccatggccatattcacagtcatcttcata
ttactggtggacctgatgcaccggcaccagcgctggacttctcgctaccctccaggccct
gtgccgtggcctgtgctgggcaacctgctgcaggtggaccccagtaacatgccatacagc
atgtacaagcttcaacaccgctatggtgacgtgttcagcctgcagatgggttggaagccc
atggtcattgtcaacagactgaaagcggtgcaggaagtgctggtgactcatggagaggac
actgctgaccgccctccagtgcccatctttaagtgcctgggtgtgaagcccagatcccaa
ggtgtggtctttgcatcttacgggcctgagtggcgagagcagaggcgattctctgtgtcc
accctgcgcaccttcggcatgggcaagaaatccctggaggagtgggtgaccaaggaggcc
ggccacctctgtgatgccttcactgcccagaatgggcggtccatcaatcccaaggccatg
ctgaacaaagccttgtgtaatgtgatcgcatccctcatttttgcccgtcgctttgaatat
gaagacccttacctcatcaggatgctgacactagtggaagaaagtttgatagaagtctct
ggtttcattcctgaggttcttaacacgttcccagcactgctgcgcatcccagggctggct
gacaaggtcttccaaggtcagaagaccttcatggccttcctggataacctgctggctgag
aacaggaccacctgggaccctgcccagccaccccgaaatctgactgatgccttcctggct
gaggtggagaaggccaaggggaatcctgagagcagctttaatgatgagaacctacgcatg
gtggtagttgacctgttcactgcagggatggtgaccaccgccaccacactgacctgggcc
ctactgctcatgattctatacccggatgtgcagcgcagagtccaacaagagattgatgag
gtcatagggcaggtgcggtgtccagagatgacagaccaggcccacatgccctacaccaat
gctgtcatccatgaggtacagcgctttggggacattgctccattgaatttgccacgcatc
acgagttgtgacattgaagtgcaggacttcgtcatccccaaggggacgaccctcatcatc
aacctgtcgtccgtgctgaaggatgagactgtctgggagaagcccctccgcttccaccct
gaacacttcctggatgcccagggcaactttgtgaagcatgaggccttcatgccattctca
gcaggccgcagagcatgccttggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcacttcagcttctccgtgccggccggacagccccggcccagcacc
cttggcaactttgctatttcagttgcccccttgccctaccagctctgtgctgcggtacgg
gagcaaggacactaa

DBGET integrated database retrieval system