KEGG   Rattus norvegicus (rat): 286993Help
Entry
286993            CDS       T01003                                 

Gene name
Taok1
Definition
(RefSeq) TAO kinase 1
  KO
K04429  thousand and one amino acid protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    286993 (Taok1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    286993 (Taok1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     286993 (Taok1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: STE group
  STE20 family
   286993 (Taok1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 286993
NCBI-ProteinID: NP_775449
RGD: 708455
Ensembl: ENSRNOG00000015692
UniProt: O88664
Position
10q24
AA seq 1001 aa AA seqDB search
MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMS
YSGKQSTEKWQDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAITHGALQGLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHMFVLRERPETVLIDLIQRTKDA
VRELDNLQYRKMKKLLFQEAHNGPAVEAQEEEEEQDHGGGRTGTVNSVGSNQSIPSMSIS
ASSQSSSVNSLPDASDDKSELDMMEGDHTVMSNSSVIHLKPEEENYQEEGDPRTRASAPQ
SPPQVSRHKSHYRNREHFATIRTASLVTRQMQEHEQDSELREQMSGYKRMRRQHQKQLMT
LENKLKAEMDEHRLRLDKDLETQRNNFAAEMEKLIKKHQASMEKEAKVMANEEKKFQQHI
QAQQKKELNSFLESQKREYKLRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEE
ANLLRRQRQYLELECRRFKRRMLLGRHNLEQDLVREELNKRQTQKDLEHAMLLRQHESMQ
ELEFRHLNTIQKMRCELIRLQHQTELTNQLEYNKRRERELRRKHVMEVRQQPKSLKSKEL
QIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKRLKEEQTRKLAILAEQYDHSIN
EMLSTQALRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSL
RRALLEQKIEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAF
SHSYPGASSWSHNPTGGSGPHWGHPMGGTPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSI
GVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaactaacagagcaggcagtctaaaggaccctgaaatcgcagagctcttcttc
aaagaagatccggaaaaactcttcacagatctcagagaaatcggccatgggagctttgga
gcagtttattttgcacgagatgtgcgtactaatgaagtggtggccatcaagaaaatgtct
tatagtggaaagcagtctactgagaaatggcaggatattattaaggaagtcaagtttcta
caaagaataaaacatcccaacagtatagaatacaaaggctgctatttacgtgaacacaca
gcatggcttgtaatggaatattgtttaggatctgcttcggatttactagaagttcataaa
aagccattacaagaagtggaaatagcagcaattacacatggtgctctccagggattagct
tatttacattctcataccatgatccatagagatatcaaagcaggaaatatccttctgaca
gaaccaggccaagtgaaacttgctgactttggatctgcttccatggcctcccctgccaat
tcttttgtgggaacaccatattggatggccccagaagtaattttagccatggatgaagga
caatatgatggcaaagttgatgtatggtctcttggaataacatgtattgaattagccgag
aggaagcctcctttatttaatatgaatgcaatgagtgccttatatcacatagcccaaaat
gaatcccctacactacagtctaatgaatggtctgattattttcgaaactttgtagattct
tgcctccagaaaatccctcaagatcgccctacatcagaggaacttttaaagcacatgttt
gttcttcgagagcgccctgaaacagtgttaatagatcttattcaaaggacaaaggatgca
gtaagagagctggacaatctacaatatcgaaagatgaagaaactccttttccaggaggca
cataatggaccagcagtagaagcacaggaagaagaggaggagcaagatcatggtggtggc
cggacaggaacagtaaatagtgttggaagcaatcagtctatccccagtatgtctatcagt
gccagtagccaaagcagcagtgttaatagtcttccagatgcatcggatgacaagagtgag
ctagacatgatggagggagaccatacagtgatgtctaacagttctgtcatccacttaaaa
cctgaggaggaaaattaccaagaagaaggagatcctagaacaagagcatcagctccacag
tctccacctcaagtgtctcgtcacaaatcacattatcgtaatagagaacactttgcaact
atacgaacagcatcactggttacaagacagatgcaagaacatgagcaggactctgaactt
agagaacagatgtctggttataagcggatgaggcgacagcatcagaagcagctgatgact
ctggaaaataaactgaaggcagaaatggacgaacatcggctcagattagacaaagatctt
gaaactcagcgcaacaatttcgctgcagaaatggagaaacttattaagaaacaccaagct
tctatggaaaaagaggctaaagtgatggccaacgaggagaaaaaattccaacaacacatt
caggctcaacagaagaaagaactgaatagctttttggagtctcaaaaaagagaatataaa
cttcgaaaagagcagcttaaggaggagctgaatgaaaaccagagcacacctaaaaaagaa
aagcaggaatggctttcaaagcagaaggagaatattcaacattttcaggcagaagaagaa
gctaatcttcttcgacgtcaaaggcagtatctagagctagaatgtcgtcgcttcaaaaga
agaatgttacttggtcggcataacttggaacaggaccttgtcagggaggagttaaacaaa
aggcagactcagaaggacttagaacatgcaatgttactgcgacagcatgaatccatgcaa
gaactggagtttcgccacctcaacactattcagaagatgcgctgtgagttgatcagactg
caacatcaaactgagcttactaaccagctggaatacaataagagaagggaacgggaacta
agacggaaacatgtcatggaagttcgacagcagcctaagagtttgaagtctaaagaactc
caaataaaaaagcagtttcaggatacctgcaaaattcaaaccagacagtacaaagcatta
aggaatcacctactggagactacaccaaagagtgagcacaaagctgttctgaaaagactc
aaggaggaacagactcggaagttagccatcttggctgagcagtatgatcatagcattaat
gaaatgctctccacacaagctctgcgtttggatgaagcacaggaagcagaatgccaggtt
ttgaagatgcagctacagcaggaactggagctgttgaatgcatatcagagcaaaatcaag
atgcaggctgaggcccaacatgatcgagagcttcgagagctggaacaaagggtctccctt
cggagagcactcttagaacagaagattgaagaagagatgttggctttgcagaatgaacgc
acagaacgaatacgtagcctgctcgagcgccaggccagagaaattgaagcttttgactct
gaaagcatgagattaggttttagtaacatggtcctttctaatctctcccctgaggcattc
agccacagctacccaggagcttctagctggtctcacaatcctactgggggttcaggacct
cactggggtcatcccatgggtggcacaccacaagcttggggtcatccgatgcaaggcgga
ccccaaccatggggtcacccctcagggccaatgcaaggggtacctcgaggtagcagtata
ggagtccgcaatagcccccaggctctgaggcggacagcttctgggggacggacggaacag
ggcatgagcagaagcacgagtgtcacttcacaaatatccaatgggtcacacatgtcttac
acataa

DBGET integrated database retrieval system