KEGG   Rattus norvegicus (rat): 286995
Entry
286995            CDS       T01003                                 

Gene name
Defa5, Defa
Definition
(RefSeq) defensin alpha 5
  KO
K05230  defensin, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05150  Staphylococcus aureus infection
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    286995 (Defa5)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    286995 (Defa5)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    286995 (Defa5)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 DUF3761 DUF1280
Other DBs
NCBI-GeneID: 286995
NCBI-ProteinID: NP_775451
RGD: 727951
Ensembl: ENSRNOG00000030093
UniProt: Q62715
Position
16q12.5
AA seq 94 aa
MRTLTLLTALLLLALHTQAKSPQGTAEEAPDQEQLVMEDQDISISFGGDKGTALQDADVK
AGVTCYCRSTRCGFRERLSGACGYRGRIYRLCCR
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaggacgctcactctgcttaccgcccttctcctgctggccctccacacccaggcaaaa
tctccccaaggaaccgctgaggaggctccagaccaggagcagctggtcatggaggaccag
gatatttccatatcctttggaggggataaaggcactgctctccaagatgcagatgtgaag
gcaggcgtgacctgctattgcagaagcacacgctgtggttttagagaacggctctctggg
gcctgtggttaccgtggccgcatctacagactgtgctgccgctga

DBGET integrated database retrieval system