KEGG   Rattus norvegicus (rat): 286996Help
Entry
286996            CDS       T01003                                 

Gene name
Zfp689, Hit39, Znf689
Definition
(RefSeq) zinc finger protein 689
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    286996 (Zfp689)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    286996 (Zfp689)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    286996 (Zfp689)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf_UBZ Zn-ribbon_8 zf-met zf-C2H2_6 zf-C2HC_2 zf-C2H2_11 A2L_zn_ribbon DUF3268
Motif
Other DBs
NCBI-GeneID: 286996
NCBI-ProteinID: NP_775452
RGD: 628696
Ensembl: ENSRNOG00000018877
UniProt: Q99PJ7 B5DEF2
Position
1q37
AA seq 500 aa AA seqDB search
MAPPSAPLLEQAPGEVGPTRRRGRRPRALKFADVAVYFSSEEWGRLRPAQRTLYRDVMRE
TYGLLGALGCAGPKPALITWLERNTDDWEPAALDPQEYRRWVTFQRKTRTRQKNEEKEVF
PPKDVPRKGKRGRKPSKPRLIARQTSGGPICPDCGCTFPDLPALESHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECSRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTL
LQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCCPN
THNGSPRPLIGGPNQRSSAL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgccttcggccccgctgcttgagcaggcacccggagaggttggacctactcgg
agaaggggcaggagaccaagggccttgaagttcgcggatgtggccgtgtacttctcctcg
gaggagtgggggcgtctgcggcccgcgcagaggactctgtaccgggatgtgatgcgcgag
acctacggcctcctgggcgcgctcggatgcgcaggtcccaaaccagctctcatcacctgg
ttggaacgaaatactgatgattgggaacccgcagccctagatccgcaggagtaccggaga
tgggtaacattccagagaaaaaccaggaccaggcagaagaatgaagagaaggaagtattc
ccacctaaggatgtaccccgaaaggggaagcgagggcggaagcccagcaaaccccggctg
attgccaggcagacatccggcggccccatctgccctgactgtggctgtaccttccctgac
ctccccgccctggagagccacaagtgcgcccagaatctgaagaaaccctacccctgcccg
gattgtgggcgccgcttttcctacccatccctgttggtcagtcacaggcgggcacactct
ggtgagtgcccttacgtttgtgaccagtgtggcaaacgtttttcccagaggaaaaacctg
tctcagcaccaagtcatacacacaggagagaagccctaccactgccctgactgtggccgc
tgctttcgacggagccggtccttggccaatcaccggaccacgcacaccggtgagaagcct
catcagtgccctagttgcgggcgtcgcttcgcctatccatctctgctcgctatccaccaa
cggacacacacaggagagaagccctacacctgcctagaatgcagccgtcgtttccgccag
cgcactgccctggtcatccaccagcgcatccacactggagagaagccttacccgtgtcct
gactgtgagcggcgtttctcctcttcctctcgcctggttagccaccggcgtgtgcactct
ggggagcggccctatgcctgtgagcactgtgaagcccgcttctctcagcgcagcaccctg
ctccagcaccagcttttgcacacaggggagaaaccctacccctgcccagactgtggccgt
gccttccgaaggagcggctccttggccatccatcgcagcacccacacggaagagaagctg
cacgcctgcgatgactgtggccgccgctttgcctatccctcgctgctggccagtcatcgg
cgtgtgcactcaggagagcggccctatgcctgtgacctttgctccaaacgctttgcccag
tggagccacttggctcagcaccagcttctgcacactggggaaaagcctttcccttgcctt
gagtgtggcaggtgcttccgccagaggtggtccctggctgtccacaagtgctgccccaac
acccacaatggcagccctagaccacttataggagggcccaatcagaggagcagtgctctt
tag

DBGET integrated database retrieval system