KEGG   Rattus norvegicus (rat): 286997
Entry
286997            CDS       T01003                                 

Gene name
Mapk15, Erk7
Definition
(RefSeq) mitogen-activated protein kinase 15
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    286997 (Mapk15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    286997 (Mapk15)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     286997 (Mapk15)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   286997 (Mapk15)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo
Other DBs
NCBI-GeneID: 286997
NCBI-ProteinID: NP_775453
RGD: 628675
Ensembl: ENSRNOG00000009336
UniProt: Q9Z2A6
Position
7q34
AA seq 547 aa
MCAAEVDRHVSQRYLIKRRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQTDAQRTFR
EIMLLREFGGHPNIIRLLDVIPAKNDRDIYLVFESMDTDLNAVIQKGRLLEDIHKRCIFY
QLLRATKFIHSGRVIHRDQKPANVLLDAACRVKLCDFGLARSLSDFPEGPGGQALTEYVA
TRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRGQPLFPGTSTFHQLELILETIPLPSM
EELQGLGSDYSALILQNLGSRPRQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQAL
QHPYVQRFHCPDREWTRGSDVRLPVHEGDQLSAPEYRNRLYQMILERRRNSRSPREEDLG
VVASRAELRASQRQSLKPGVLPQVLAETPARKRGPKPQNGHGHDPEHVEVRRQSSDPLYQ
LPPPGSGERPPGATGEPPSAPSGVKTHVRAVAPSLTSQAAAQAANQPLIRSDPARGGGPR
AVGARRVPSRLPREAPEPRPGRRMFGISVSQGAQGAARAALGGYSQAYGTVCRSALGRLP
LLPGPRA
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtgtgctgccgaggtggaccgtcatgtatcccagagatacctgatcaagcggaggctt
gggaagggggcctacggcattgtatggaaggccatggaccggaggactggtgaggtagtg
gccatcaagaaaatctttgatgcctttagggaccagacagatgctcagaggaccttccgt
gaaatcatgcttctccgggagtttgggggccatcccaacatcatccgcctgcttgatgta
atcccagcaaagaatgacagggatatttacctggtgtttgagtccatggacaccgacctg
aacgcggtcatccagaagggcagactgttggaggacatccacaaacgttgcatcttttac
cagctcctgagagccaccaagtttatccattcagggcgcgtcattcaccgggaccagaag
ccagccaacgttctattggatgctgcttgccgggtgaaactatgtgactttggcctggca
cgctccctcagtgacttccctgaagggcctgggggccaggccctgacagaatatgtggcc
acacgctggtaccgagctccagaggtgcttctgtcttcccgatggtatacccctggggtg
gacatgtggagcctgggctgcatactgggagagatgcttcgagggcagccactgtttccg
ggtacatctactttccaccagctggagctgatcctggagaccattccattgccctccatg
gaggagctccagggccttggatcagactacagtgctttgattctgcagaatcttggatcc
aggccacggcagacgctggacgccctcctgccgccagacacccccccagaagccctggac
ctcctcaagcgactcttggcatttgctccggacaaacggcttagtgcagagcaggctctt
caacacccttacgtgcagagattccattgccccgaccgcgagtggacacgggggtccgat
gtgcggctcccggtacacgaaggagaccagctctctgcaccagagtatcgcaaccgcctg
taccagatgatcctggagcggagacggaacagccgcagccctcgagaggaagacttgggg
gttgtggcctcgcgggcagagctcagggcttcccagaggcaatcgctcaagcccggagtc
ctcccccaggtcttggcggagacgcctgcgcggaaacgcggacccaaacctcagaatggc
catggtcacgatcccgagcatgtggaagttcgcaggcagagttcagaccccctgtaccaa
cttccgccgccaggcagcggggaaaggcccccaggggccacaggggagccaccctccgca
ccctcaggggtgaagactcacgttagggcggtggcgccctccctgacttcacaggccgcg
gctcaggcggccaatcagcctctgatccgcagtgatccggcccggggcggtgggccaagg
gctgtcggcgcgcgacgggtcccttcccgcctgccccgggaggccccggaaccccgaccc
ggccgaaggatgtttggcatctcggtctcgcagggggcccagggtgcagccagagctgct
cttggcggctactcccaggcctacgggaccgtgtgccgctccgcgctgggccgcctgcct
ctgctccccggaccgcgtgcgtga

DBGET integrated database retrieval system