KEGG   Rattus norvegicus (rat): 287034Help
Entry
287034            CDS       T01003                                 

Gene name
Tnfrsf17
Definition
(RefSeq) TNF receptor superfamily member 17
  KO
K05153  tumor necrosis factor receptor superfamily member 17
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287034 (Tnfrsf17)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    287034 (Tnfrsf17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    287034 (Tnfrsf17)
   04090 CD molecules [BR:rno04090]
    287034 (Tnfrsf17)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   287034 (Tnfrsf17)
CD molecules [BR:rno04090]
 Proteins
  287034 (Tnfrsf17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCMA-Tall_bind TACI-CRD2
Motif
Other DBs
NCBI-GeneID: 287034
NCBI-ProteinID: NP_001099231
RGD: 1304703
Ensembl: ENSRNOG00000021987
UniProt: D3ZKQ8
Position
10q11
AA seq 184 aa AA seqDB search
MAQRCFHSEYFDSLLHACKPCRLRCSNPPAPCQPYCDPSMTSSVRGTYTVLWIFLGLTLV
VCLALFTLSFLLRKMNPEALKDKPQSPGHLDGSVQLDKADTERTKSRAGDERILPRSLEY
TVEECTCEDCIKSNPKGDSDHFFPLPAMEEGATILVTTKTGDYGKGMPSALQSVMGMEKP
AHSR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcggtgcttccacagtgaatattttgacagtctgctgcatgcttgcaaaccg
tgtcgcctgcgatgttccaaccctcctgcaccctgtcagccttactgtgatccaagcatg
accagctcagtgagagggacgtacacggttctctggatcttcttgggcctgaccttggtc
gtctgtttggcacttttcacactctctttcttgctgaggaagatgaacccggaggccctg
aaggacaagcctcaaagcccaggccatcttgacggatccgttcagctggacaaggccgat
actgagcggactaagagcagggctggtgacgaaaggattcttccccgaagcctggagtat
acagtggaagagtgtacctgtgaggattgcatcaagagcaaccccaagggtgattctgac
catttcttcccacttccagccatggaggagggggcgaccattcttgtcaccacgaaaacg
ggtgactatggcaagggtatgccaagtgctttgcaaagtgtcatggggatggagaagcca
gctcactccagataa

DBGET integrated database retrieval system