KEGG   Rattus norvegicus (rat): 287069Help
Entry
287069            CDS       T01003                                 

Gene name
Trap1
Definition
(RefSeq) TNF receptor-associated protein 1
  KO
K09488  TNF receptor-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    287069 (Trap1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP90
   287069 (Trap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c
Motif
Other DBs
NCBI-GeneID: 287069
NCBI-ProteinID: NP_001034090
RGD: 1359733
Ensembl: ENSRNOG00000005418
UniProt: Q5XHZ0
Position
10q12
AA seq 706 aa AA seqDB search
MARELRALLLWGRGLQSALRAPALAGVRRGKPVLHLQKTTVHFRDPTQSLASGISAGQLY
STQAAEDKKEEALHSIISNTEAVQGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELIS
NASDALEKLRHKRVCEGQVLPEMEIHLQTDAEKGTITIQDTGIGMTKEELVSNLGTIARS
GSKAFLEALQHQAETSSRIIGQFGVGFYSAFMVADKVEVYSRPAAPESPGYQWLSDGSGV
FEIAEASGVRPGTKIIIHLKSDCKDFANESRVQDVVTKYSNFVSFPLYLNGRRINTLQAI
WMMDPKDISEFQHEEFYRYIAQAYDKPRFILHYKTDAPLNIRSIFYVPEMKPSMFDVSRE
LGSSVALYSRKVLIQTKATDILPKWLRFVRGVVDSEDIPLNLSRELLQESALIRKLRDVL
QQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTTAEQDIKEDIAKLLRYESSALPAG
QLTSLSDYASRMQAGTRNIYYLCAPNRHLAEHSPYYEAMKQKQTEVLFCYEQFDELTLLH
LREFDKKKLISVETDIVVDHYKEEKFEDTSPAGERLSEKETEELMAWMRNALGSRVTNVK
VTFRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHTLIKKLNQLR
EREPELAQLLVDQIYENAMIAAGLVDDPRAMVGRLNDLLVKALERH
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgagagctgcgagctctgctgctgtggggccgcgggctgcagtctgcactgagg
gctcccgcgctggcgggagtccggcgaggaaagccagttctgcaccttcagaagaccaca
gtccactttagggaccccacacaaagtctggcttcagggatctctgcaggacagttatat
agcacacaggcagctgaggacaagaaggaggaggccctgcactccataatcagcaacact
gaggctgtgcaaggttctgtctccaaacatgagttccaggcagagacaaagaagcttttg
gacattgtagcccgttcactgtactcggaaaaagaggtattcatacgagagctcatctcc
aacgccagcgatgccttggagaaactgcggcacaagcgggtgtgtgaaggccaggtgctg
ccagaaatggagattcaccttcagacggatgccgagaagggcaccatcaccatccaggac
actgggattgggatgaccaaggaggagctggtgtccaaccttggcacaatcgccagatca
gggtcaaaggctttcctggaagcactgcagcaccaggcagagaccagcagcaggatcatc
ggccagtttggagtgggcttctattctgccttcatggtggctgacaaagttgaagtctat
tctcgaccggcagccccagagagcccaggttaccagtggctttcagatggttctggagtg
tttgaaattgctgaagcttcaggagttagacctgggaccaaaataatcatccacctcaag
tcagactgcaaagatttcgccaacgagtcccgggtgcaagatgtggtaacaaagtacagt
aactttgtcagcttccccctgtaccttaacggaaggcggattaacactttgcaggccatc
tggatgatggacccaaaggacatcagtgaatttcagcacgaggaattctaccgttacatc
gcacaggcttacgataagcctcgcttcattttgcactacaagacggacgccccactcaat
atccgcagcatcttctatgtgccagagatgaaaccatccatgtttgacgtgagcagggag
ctgggctccagtgtggcactgtatagccgcaaggtgctcatccagaccaaggctacggat
atcctgcccaagtggctgcgcttcgttcgaggtgtggtggacagtgaggacatccccctg
aacctcagccgagagctcctgcaggagagcgccctcatccggaaactccgggacgttcta
caacagagattgatcaaattcttcattgaccagagtaaaaaagatgctgaaaaatatgcc
aagttttttgaagattatggcttgttcatgagggagggcattgtgaccaccgctgagcaa
gacatcaaggaggatattgcaaagctgctacggtatgagtcctcagccctgcctgctggg
cagctgaccagcttatcagactacgccagccgaatgcaggctggcacccgcaacatctat
tacctgtgtgcccctaaccgtcacctggctgaacattcaccctattatgaagccatgaag
cagaaacagactgaggtgctcttctgctacgagcagttcgacgagctcactctgctgcac
ctgcgggagtttgacaagaagaagctgatctctgtggagacggacatcgtcgttgatcac
tacaaggaggaaaagtttgaggacacatctccagctggtgagcgcctctctgagaaagaa
acagaagagctaatggcatggatgagaaatgcactggggtcccgtgtcaccaatgtgaag
gtgactttccgcctggacacccaccctgccatggtgaccgtgctagagatgggggctgct
cgacatttcctgcgcatgcagcagctggccaagacccaggaggagcgtgctcagttgcta
cagcccacactggagatcaaccccaggcacacactaataaagaaactcaaccagctgagg
gagcgtgagccggagctagcccagctgctagtggatcagatctatgagaacgccatgata
gcagcaggactcgttgatgatccccgggccatggtaggccgcctgaatgaccttctggtc
aaggccctggagagacactga

DBGET integrated database retrieval system