KEGG   Rattus norvegicus (rat): 287099Help
Entry
287099            CDS       T01003                                 

Gene name
Cldn9
Definition
(RefSeq) claudin 9
  KO
K06087  claudin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    287099 (Cldn9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    287099 (Cldn9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    287099 (Cldn9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    287099 (Cldn9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    287099 (Cldn9)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   287099 (Cldn9)
  Exosomal proteins of colorectal cancer cells
   287099 (Cldn9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF872
Motif
Other DBs
NCBI-GeneID: 287099
NCBI-ProteinID: NP_001011889
RGD: 1308999
Ensembl: ENSRNOG00000003654
UniProt: Q5PPJ3
Position
10q12
AA seq 217 aa AA seqDB search
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
LCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcttccactggccttgaactcctcggcatgaccctggctgtgctaggctggctagga
accctggtgtcctgtgccctgccactgtggaaggtgaccgccttcattggcaacagcatc
gttgtggcccaagtggtatgggaggggctgtggatgtcctgtgtggtccagagcactggg
cagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggctgcc
agagccctctgtgtcgtggccctcctgctggctttgctgggcctgctggtggctatcacg
ggcgcccagtgcaccacatgtgtggaggacgaaggtgccaaggcacgtattgtgctcacc
gcaggggtcctcctcctcctctcgggcatcctggtgctcatccccgtctgctggacagcc
catgccatcatccaggacttttataacccactggttgctgaagctctcaagagagagctg
ggggcttccctctacctgggctgggccgccgctgcactgctcatgctcggaggagggctc
ctctgctgtacgtgtcccccgtcccacttcgagaggccccgcggccccaggctgggctac
tccatcccttcccgttcaggtgcttcgggacttgataagagggactatgtgtga

DBGET integrated database retrieval system