KEGG   Rattus norvegicus (rat): 287101Help
Entry
287101            CDS       T01003                                 

Gene name
Pkmyt1, RGD1305434
Definition
(RefSeq) protein kinase, membrane associated tyrosine/threonine 1
  KO
K06633  membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    287101 (Pkmyt1)
   04114 Oocyte meiosis
    287101 (Pkmyt1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    287101 (Pkmyt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     287101 (Pkmyt1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  WEE family
   287101 (Pkmyt1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     287101 (Pkmyt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 287101
NCBI-ProteinID: NP_001099236
RGD: 1305434
Ensembl: ENSRNOG00000003657
UniProt: G3V6G8
Position
10q12
AA seq 490 aa AA seqDB search
MSMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPGGLSRSLPPRPPAKGSIPVSRLFPP
RTPGWQQPQPRRVSFLCETSETLQSPGYDPSRPESFFQQNFQRLSRLGHGSYGEVFKVRS
KEDGRLYAVKRSMSPFRGPKDRTRKLAEVGGHEKVGQHPHCVRLERAWEEGGILYLQTEL
CGPSLQQHCEAWGASLPEAQVWGYLRDTLLALDHLHSQGLVHLDVKPANIFLGPRGRCKL
GDFGLLVELGSAGAGEAQEGDPRYMAPELLRGSYGTAADVFSLGLTILEVACNMELPHGG
EGWQQLRQGYLPPEFTAGLSSELRSVLTMMLEPDPQLRATAEVLLALPMLRQPRPWNVLW
YMAAEALSRGWALWQALVTLLCWLWHGLVHPASWLQPPGPPATPPGSPPCSPLLDSTLSS
NWDDDSIGPSLSPETILSRITRRTSTPRGRYTPRDVLDLTDMDSEPPRGPCPTFEPRNLL
SLFEDSLDPA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgcccactgagggcaccccaccacccctaagtggtacccccatcccagttcca
gcttacttccgacatgcagaacctggtttctccctcaaaaggcctgggggcctcagccgg
agccttccacctcggccccctgccaagggcagcatccctgtcagccgtctattcccccct
cggacccccggctggcagcagccccagccccggagggtgtctttcctgtgcgagacctca
gagacgttgcagagccctgggtacgacccgagccggccagagtccttctttcagcagaat
ttccagaggctcagccgactgggtcatggctcctatggagaagtcttcaaggtgcgctcc
aaggaagatgggcgactctatgctgttaagcgctccatgtcaccattccgaggccccaaa
gatcggactcgtaaactggctgaggtaggcggccacgagaaggtggggcagcacccacat
tgcgtgagactggagcgggcctgggaggagggtggcatcctatacctgcagacagagctc
tgtgggcccagcctgcagcaacactgtgaagcctggggggccagcctgccagaggcccag
gtctggggctacttgcgggacactcttctggctctggaccatctacacagtcaaggccta
gttcacctggatgttaagcctgccaacatcttcttgggcccccggggccgctgcaagctg
ggcgactttggactactggtggagctcggttcagccggtgctggcgaggcccaggaggga
gatcctcgctacatggctccagaactgctgcggggctcctatgggacagctgcagatgtg
ttcagtctgggtctcaccatcttggaagtggcctgcaatatggaactgccccacggtggg
gagggatggcagcagctgcgccagggatacttgccgcccgagttcactgctggtctgtct
tctgagctgcgttctgtcctcaccatgatgttggagcctgacccccagcttcgagccacg
gctgaggtcctgctggccttgcccatgctgaggcagccacgtccctggaatgttctgtgg
tatatggctgcagaagccctgagtcgaggttgggccctgtggcaggctctggtcactctg
ctctgctggctctggcatggcctggttcatcctgccagttggctgcagcctccaggccca
ccagccacaccacctggctctccaccatgcagtcccctcctggacagcaccctctccagc
aactgggatgatgacagcataggcccctcactttccccagagaccatcctgtcccggatc
acgaggagaacctctacccctcggggcaggtacacaccaagggatgtcctggacctaact
gatatggactcagagcctccaagaggtccctgccccacctttgagccaaggaatctcctc
agcctgtttgaggactccctagacccagcctga

DBGET integrated database retrieval system