KEGG   Rattus norvegicus (rat): 287102
Entry
287102            CDS       T01003                                 

Gene name
Kremen2
Definition
(RefSeq) kringle containing transmembrane protein 2
  KO
K23091  kremen protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    287102 (Kremen2)
SSDB
Motif
Pfam: Kringle WSC CUB
Other DBs
NCBI-GeneID: 287102
NCBI-ProteinID: NP_001099237
RGD: 1310795
Ensembl: ENSRNOG00000004122
UniProt: D4ADS5
Position
10q12
AA seq 468 aa
MGTPDLQGLLLLFPLLLPPHGASAGSLHSPGLSECFQVNGADYRGHQNYTGPRGAGRPCL
FWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLA
RGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVIYSPDFPDEYGP
DRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDASSGNLLRAFDGAHPPPPGPLHLRT
AALLLTFRSDARGHAQGFALTYRGLQDTVEDRASPEDSAETLAGNPDGANVSCSPKPGAA
QASIGGEADLQARVFSTVMAISVLLLLLLLSLLRLLRRRSCLLAPGKGSLAMGPSRGPGR
SWAVWYRRPRGVALPCPPGDSQAEGPAAGYRPLSASSQSSLRSLVSAL
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggggacaccagatctgcagggcctcctcctcctcttcccgttgctgctgccgccgcac
ggggcctcagcagggagcctgcacagtccaggcctgtccgaatgcttccaggtgaacggc
gctgactaccgcggccaccagaactacaccggcccgcgcggagctggacgcccttgtctt
ttctgggaccagacgcagcagcacagctacagcagcgccagcgatccccagggccgctgg
gggctgggtgcgcacaacttctgtaggaacccggacggcgatgtgcagccctggtgctat
gtggcagagacagaagaaggcatctactggcgctactgtgatatccccacgtgtcacatg
cctgggtacctgggctgcttcgtagactctggggcaccccctgctctcagtggtcccagt
ggcacctccacaaagctcacagtccaggtgtgccttcgattctgccgcatgaagggctac
cagctggctggcgtggaggctggttatgcctgcttctgtggctctgaaagtgacctggcc
cggggacgtccagcccctgccaccgactgtgaccagatctgttttggccacccaggccaa
ctgtgtggaggtgatggacgactgggtatctatgaagtgtctgtgggttcctgccaggga
aactggacggctcctcagggtgtcatctactccccggattttccggatgagtatggacca
gaccggaactgcagctgggtactgggccaactgggcgctgtgctagagctcaccttccgc
ctcttcgagttggctgactctcgagaccggctggagctacgcgacgcctcatctggcaac
ctgctccgtgccttcgacggcgcccatccgccgccgcccgggccgctgcacctgcgcact
gctgcactgctgctcaccttccgcagcgacgcacgaggccatgctcaaggcttcgcgctc
acctaccgggggctgcaggatacagtggaggacagagcgtctccagaggattcagctgag
actctcgcagggaaccccgatggggctaacgtgagctgcagccccaagcctggagcggca
caggcttccataggtggtgaggctgatttgcaagcccgagtcttctccaccgtgatggcc
atctctgtgctgctgctgctgctgctcctgtcgctactgcgtttgctgcgtcgacggagc
tgtctgctggctccaggaaaagggtctctggccatgggaccttcccggggccccgggaga
agctgggctgtgtggtaccgccggccccgaggggtggccctgccctgtcccccaggggac
tctcaggctgagggtcctgctgcgggctaccggcccctgagtgcctccagccagagctcc
ttgcgctcgctcgtctctgctctctga

DBGET integrated database retrieval system