KEGG   Rattus norvegicus (rat): 287110
Entry
287110            CDS       T01003                                 

Gene name
Tbc1d24, RGD1306143
Definition
(RefSeq) TBC1 domain family, member 24
  KO
K21841  TBC1 domain family member 24
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    287110 (Tbc1d24)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    287110 (Tbc1d24)
SSDB
Motif
Pfam: RabGAP-TBC TLD
Other DBs
NCBI-GeneID: 287110
NCBI-ProteinID: NP_001099239
RGD: 1306143
Ensembl: ENSRNOG00000052204
UniProt: D4A3Z3
Position
10q12
AA seq 556 aa
MDSPGYNCFVDKDKMDASIQDLGPKELNYTELQELKQLARQGYWAQSHALRGKVYQRLIR
DIPCRTVTPDASVYSDIVGKIVGKHSSSSLPLPEFVDNTQVPTYCLNPRGEGAVRKILLC
IANQFPDISFCPALPAVVALLLHYSIDEAECFEKACRILSCNDPGKKLIDQSFLAFESSC
MTFGDLVNKYCQAAHKLMVAVSEDVLQVYSDWQRWLFGELPLNYFARVFDVFLVEGYKVL
YRVALAILKFFHKVRAGQPLESDNVKQDIRMFVKDIAKTVSPEKLLEKAFAIRLFSRKEI
QLLQMANEKALRQKGITVKQKRQFVHLAVHAENFRSEIVSVKEMRDIWSWIPERFALCQP
LLLFSSLQHGYSLSRFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERNKFGGKLSFFG
TGECFVFRLQPEVQRYEWVVIKHPELTKAASFKSSEAAANPCLISHSVSSDPADRLSPFL
AARHFNLPSKTESMFMAGGNDCLIIGGGGGQALYIDGDLNRGRTGHCDTFNNQPLCSESF
LIAAVEAWGFQDPDTQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggactccccagggtacaattgctttgtggataaggacaagatggacgcgtccatccag
gacctggggccaaaggagctgaactacaccgagctacaggagctgaagcagctggcgcgg
cagggttactgggctcagagccacgccctgcgggggaaagtgtaccagcgtctgatccgg
gacatcccctgccgcacggtcacacccgacgccagcgtgtacagcgacatcgtggggaag
attgtgggcaagcacagcagcagtagcttgcccctgcctgagtttgtagacaacactcag
gtgcccacctactgcctgaacccgcggggtgagggggccgtgcgcaagatcctcctgtgc
atcgccaaccagttccccgacatctccttctgccctgccctgcccgcggtggtggccttg
ctgctacactacagcattgacgaggccgagtgctttgaaaaggcctgccgcatcttgtcc
tgcaacgaccccggcaagaagctcattgaccagagcttcctggccttcgagtcttcctgt
atgacgtttggagacctggtgaacaagtactgccaggcagcccacaaactgatggtggcc
gtgtcagaggacgttctgcaggtctactctgactggcagagatggctctttggggagctg
cccctcaactactttgcccgcgttttcgacgtcttccttgtagaaggctacaaggtactg
taccgagtcgctctggccatcctcaagttcttccacaaggtgagagcaggacagcccctt
gagtcagacaatgtaaagcaagacatccggatgtttgtcaaggacattgccaagacagtg
tcccctgagaaactactagagaaggcctttgccatccgcctgttttcccgcaaggagatt
cagctcttgcaaatggccaatgagaaagccctgaggcagaagggtattactgtcaaacag
aagaggcagtttgtacacttggctgtccatgcagagaacttccgctcagagattgtcagt
gtgaaggagatgagagacatttggtcctggatccctgagcgcttcgccctctgccaaccc
ctcctgctcttctcgtcgctgcagcatgggtacagcctaagcaggttctatttccagtgc
gaaggacatgagcccacactcctgctcatcaagaccactcaaaaggaggtttgtggggct
tacctgtcaacagactggagtgagcggaataagttcggaggcaagctgagcttctttggg
actggagaatgctttgtttttaggctgcagccggaggtgcagcgctatgagtgggtggtc
atcaagcacccagaactgaccaaggcagcatccttcaagtcctcagaggctgcagccaat
ccttgcctcatcagccactccgtctcttcagaccctgccgaccggctctctcctttcctg
gctgcccggcacttcaacctgccctccaagaccgagtccatgttcatggctgggggcaac
gactgcctcatcattgggggaggaggtggccaagcactctacatcgatggggatctgaac
cgagggcgcaccggacactgtgacacgttcaacaaccagcccctgtgctcggagagcttc
ctcatcgcggccgtggaggcttggggcttccaagaccccgacacccagtga

DBGET integrated database retrieval system