KEGG   Rattus norvegicus (rat): 287113
Entry
287113            CDS       T01003                                 

Gene name
Rnps1
Definition
(RefSeq) RNA-binding protein with serine-rich domain 1
  KO
K14325  RNA-binding protein with serine-rich domain 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    287113 (Rnps1)
   03015 mRNA surveillance pathway
    287113 (Rnps1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    287113 (Rnps1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     287113 (Rnps1)
SSDB
Motif
Pfam: RRM_1 RRM_7 RRM_5 RRM_3 Nup35_RRM_2 Macoilin RRM_occluded LAP1C
Other DBs
NCBI-GeneID: 287113
NCBI-ProteinID: NP_001011890
RGD: 1307522
Ensembl: ENSRNOG00000008703
UniProt: Q6AYK1
Position
10
AA seq 305 aa
MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGTTKESSEKDRGRD
KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSS
SGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEI
FSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLA
PWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSS
SNSSR
NT seq 918 nt   +upstreamnt  +downstreamnt
atggatttatcaggagtgaaaaagaagagcttgctaggagtcaaagagaataataaaaag
tccagcactagggctccttctcctaccaaacgaaaggaccgctctgatgagaagtccaag
gatcgatctaaagataaagggaccactaaagagtccagtgagaaggatcgtggcagagat
aagacccggaagagacgcagtgcttcaagcggaagcagcagcaccaggtccaggtccagc
tcaacctccagctcgggctccagcaccagcacgggctcgagcagtggctctagctcgtct
tctgcgtccagccgctcaggaagctccagcacatcccggagctccagttccagcagctcc
tccggctccccaagcccttctcggcgcagacatgacaacaggcggcgttcccgctccaaa
tccaaaccacctaaaagagatgaaaaagagaggaaaaggcggagcccttcacctaaaccc
accaaagtgcacattgggaggctcaccaggaatgtgaccaaggatcatatcatggaaata
ttttctacttacgggaaaattaaaatgattgacatgcctgtggaaaggatgcatcctcat
ctatccaaaggctatgcgtacgtggaattcgagaatccggatgaagcagagaaggcactg
aaacacatggatggaggacaaatagatggccaagagatcactgctactgcggtgttggca
ccctggcctcgtccaccgcctcggcgattcagcccacccaggagaatgcttccaccgcct
cccatgtggcgtaggtcacccccacggatgaggagaaggtctcgatccccaagacgcagg
tcccctgtgcgaaggaggtctcgatcgcctggccgccgccgccacaggagccgatccagc
tccaactcctcccgataa

DBGET integrated database retrieval system