KEGG   Rattus norvegicus (rat): 287115Help
Entry
287115            CDS       T01003                                 

Gene name
Pgp, AUM, G3PP, RGD1307773
Definition
(RefSeq) phosphoglycolate phosphatase
  KO
K19269  phosphoglycolate phosphatase [EC:3.1.3.18 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    287115 (Pgp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    287115 (Pgp)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     287115 (Pgp)
    3.1.3.48  protein-tyrosine-phosphatase
     287115 (Pgp)
Protein phosphatases and associated proteins [BR:rno01009]
 HAD phosphatases
  Other HAD phosphatases
   287115 (Pgp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase
Motif
Other DBs
NCBI-GeneID: 287115
NCBI-ProteinID: NP_001162623
RGD: 1307773
Ensembl: ENSRNOG00000009536
UniProt: D3ZDK7
Position
10q12
AA seq 321 aa AA seqDB search
MAEAEAGGDEVRCVRLSAERAKLLLAEVDTLLFDCDGVLWRGETAVPGAPETLRALRARG
KRLGFITNNSSKTRTAYAEKLRRLGFGGPMGPEAGLEVFGTAYCSALYLRQRLAGVPDPK
AYVLGSPALAAELEAVGVTSVGVGPDVLHGDGPSDWLAVPLEPDVRAVVVGFDPHFSYMK
LTKAVRYLQQPDCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFI
FDCVSQEYGINPERTVMVGDRLDTDILLGSTCSLKTILTLTGVSSLEDVKSNQESDCMFK
KKMVPDFYVDSIADLLPALQG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcggaggccggcggcgacgaagtccgctgcgtgcggctgagcgccgagcgg
gccaagttgctgctggccgaagtggacacgctgctgttcgactgcgatggcgtgctgtgg
cgcggcgagacggccgtgccgggcgcgccggagactctgcgggcgctgcgggcccgcggc
aagcgactgggcttcatcaccaacaacagcagcaagactcgtacggcctacgcggagaag
ctcaggcgcttgggtttcggtggcccgatggggcccgaagcgggcctcgaggtcttcggc
acggcctactgcagcgcgctctatctgcgccaacgcctggccggcgtgccggaccccaag
gcctacgtgctgggcagcccggccttagccgcggagctggaggccgtgggtgtcactagc
gtgggcgtgggcccggacgtgcttcacggcgatggcccaagcgactggctagccgtgccg
ctcgaacccgacgtgcgcgcggtagtggtgggcttcgacccacacttcagctacatgaag
cttaccaaggccgtgcggtacctgcagcagcccgactgtctgctcgtgggcaccaacatg
gacaaccggctcccgctagagaacggccgtttcattgcgggtaccggctgtctggtgcga
gccgtggagatggccgcccagcgccaggcggacatcatcgggaagcctagccgcttcatc
ttcgactgcgtgtcccaggagtatggtatcaacccggagcgcaccgtcatggtgggagac
cgcctggacacagacatcctcctgggctccacctgtagcctgaagactatcctgaccctc
accggagtctccagtcttgaggatgtgaagagcaatcaggaaagtgactgcatgttcaag
aagaaaatggtccctgacttctatgttgacagcatagccgacctcttgcctgcccttcaa
ggttaa

DBGET integrated database retrieval system