KEGG   Rattus norvegicus (rat): 287134
Entry
287134            CDS       T01003                                 

Gene name
Gnptg
Definition
(RefSeq) N-acetylglucosamine-1-phosphotransferase subunit gamma precursor
  KO
K10087  N-acetylglucosamine-1-phosphate transferase, gamma subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    287134 (Gnptg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    287134 (Gnptg)
Lectins [BR:rno04091]
 P-type lectins
  287134 (Gnptg)
SSDB
Motif
Pfam: PRKCSH_1 PRKCSH AltA1
Other DBs
NCBI-GeneID: 287134
NCBI-ProteinID: NP_001093963
RGD: 1311614
Ensembl: ENSRNOG00000024455
UniProt: B0BNH1
Position
10
AA seq 306 aa
MAGRLTGFLMLLGLAAQGPAPTHAGKMKVVEEPNTFGLNNPFLPQASRLQPKREPSAVSG
PPHLFRLAGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIVNNTFKG
MWMTDGDSCHSRSRQSKVELTCGKTNRLAHVSEPSTCVYALTFETPLVCHPHSLLVYPTL
SEALQQRWDQVEQDLADELITPQGYEKLLRALFEDAGYLKVPGETHPTQLAGDSKGLGLE
TLDICRKAHAELSREVQRLTSLLEQHGIPHTQPTETTHSQLLGQQLPVGEISEQLRGDPG
LRGNIL
NT seq 921 nt   +upstreamnt  +downstreamnt
atggcggggcggctgactggcttcctgatgttgctggggctcgcggcgcaggggcctgcg
ccgacacatgccgggaagatgaaggtggtggaggagcccaacactttcgggctgaataac
ccgttcttgccccaggcaagccgacttcagcccaagagagagccttcggctgtatctggg
cccccgcatctcttcagactcgctggcaagtgcttcagcctagtggagtccacgtacaag
tatgaattctgccctttccacaacgtgacccagcatgagcagaccttccgttggaacgcc
tacagcgggatccttggcatctggcatgagtgggagatcgtcaacaacaccttcaagggc
atgtggatgactgatggggactcctgtcactcccggagccggcagagcaaggtggagctc
acctgtggaaagaccaaccgactggcccacgtgtctgaaccaagcacctgcgtctatgca
ttgacatttgagacccctcttgtctgccatccccactctctgttagtgtatccaaccctg
tcagaggccctgcagcagcgctgggaccaggtggaacaggacctggcggacgagctgatc
acaccgcagggctatgagaagttgctgagggcactttttgaggatgctggctacttaaag
gtcccaggagaaacccaccccacccagctggcaggagattccaagggcctggggcttgag
actctggacatttgcagaaaggcacacgcagagctgtcacgggaggtacaaagactgaca
agtctgctcgaacagcatggaatcccacacactcagcccacagaaaccacccactctcag
ctcctgggtcagcagctcccggtaggtgaaatctcagagcagttgcggggcgacccagga
ctacgagggaacatcctgtga

KEGG   Rattus norvegicus (rat): 362865
Entry
362865            CDS       T01003                                 

Gene name
Gnptab
Definition
(RefSeq) N-acetylglucosamine-1-phosphotransferase subunits alpha/beta isoform X2
  KO
K08239  UDP-N-acetylglucosamine-lysosomal-enzyme [EC:2.7.8.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    362865 (Gnptab)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.17  UDP-N-acetylglucosamine---lysosomal-enzyme N-acetylglucosaminephosphotransferase
     362865 (Gnptab)
SSDB
Motif
Pfam: Stealth_CR2 GlcNAc-1_reg DMAP_binding Stealth_CR3 Notch Stealth_CR1 EF-hand_1 EF-hand_5 EF-hand_7
Other DBs
NCBI-GeneID: 362865
NCBI-ProteinID: XP_017450686
RGD: 1564821
Ensembl: ENSRNOG00000005228
Position
7
AA seq 1172 aa
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREHMEEEQKAMREILGKNTTEPTK
KSERQLECLLTHCIKVPMLVLDPPLPANCTLKDLPALYPSFHAASDMFNIAKPKNPSTNV
SVVVFDTTKDVEDAHAGLFKGSSKQTVWRAYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
IQLKTKLPENLSSKIKLLQLYSEASVALLKLNNPKGFPELNKQTKKNMSISGKELAISPA
YLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDIFQNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSAGSRYVAG
GGGTGNIGVGQRWQFGGGINTISYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHF
HELYKVTLLPNQTHYVVPKGEYLSYFSFANIAKRGVEGTYSDNPIVRHASIANKWKTIHL
IMHSGMNATTIYFNLTLQNSNDEEFKIQIAVEVDTREVPKPNSTTQKTYDNLVSPVTPLP
QADVPFEDVPKEKRFPRVRRPDVNATGKVQEEVKIPRVNISLLPKEAQVRLSNLDSQLER
GDITLKGYNLSKSALLRPFLRNSLDTKGKPQAGTDETKDNLEVPQEDPSHQRPRGFAAAR
RPERWTTPAETATVNGRDHGLNPPPTQPVPKENLSPLIIPPEGRMPKEGDRDRAEGNADS
HVPVNELVPGRRLQQHIPSYPGFLPWEKNKYFQDLLDEEESLKKQLAYFTDSRHAGRQLK
DTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHS
EDMQFAFSYFYYLMSAVQPLNLSQVFDEVDTDQSGVLSDREIRTLATRVHDLPLSLQDLT
GLEHMLINCSKLLPANITQLSNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDK
NKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPSPSYPGILPVDQATLKLKRSARLC
PASAEIKGMRHHAVLSVTSKVVPASSFFFPEL
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgctgcttaagctcctgcagagacagacctatacctgcctatcccacaggtatgggctc
tacgtctgcttcgtgggcgtcgtggtcaccatcgtctcggctttccagttcggagaggtg
gttctggaatggagccgtgatcaataccatgttttatttgattcctacagagacaacatt
gctgggaaatcctttcagaatcggctctgtctgcccatgccaattgatgtggtttacacc
tgggtgaatggcacggacctcgaactgctaaaggaactacagcaggtccgggagcacatg
gaggaagaacagaaagccatgcgggaaatcctcgggaagaacacaaccgaaccaacgaag
aagagtgagaggcagctggagtgtctcctgacgcactgcattaaggtgcccatgcttgtt
ctggaccctccgctgccagccaactgcaccctgaaggacctgccagctctttatccatcg
tttcacgctgccagcgacatgttcaacatcgcaaaacccaaaaatccatctactaatgtc
tcggttgtcgtttttgacactaccaaggatgttgaagacgcccatgctggactgtttaaa
ggaagcagcaagcagacagtgtggagagcctacttgacaacagacaaagaagtcccaggc
ttagtgctgatgcaagacctggcgttcctgagtggattcccaccaacattcaaggagacg
attcagctgaagacaaaactgccagaaaatctttcttctaaaataaaactgttgcagctg
tactcggaggccagcgtcgctcttctgaaattgaataaccccaaaggtttccccgagctg
aacaagcagaccaagaagaacatgagcatcagtgggaaggaactggccatcagccctgcc
tatctgctgtgggacctgagcgccatcagccagtccaagcaggatgaagatgtgtctgcc
agccgcttcgaggataacgaagagctgaggtactcactgagatctatcgagagacatgcg
ccatgggtacggaatattttcattgtcaccaacgggcagattccatcctggctgaacctt
gacaaccctcgagtgaccatcgtgacccaccaggacattttccaaaacctgagccacttg
cctaccttcagctcccctgccattgaaagccacatccaccgcatcgaggggctgtcccag
aagttcatttatctaaatgacgatgtcatgtttggtaaggacgtttggcccgatgacttt
tacagccactccaaaggtcaaaaggtttatctgacatggccggtgccgaattgtgcagag
ggctgcccgggctcctggatcaaagacggctactgtgataaggcctgtaataactcagcc
tgtgactgggatggcggagactgctctggtaatagcgcagggagtcgctatgtcgccgga
ggcgggggtaccggcaatattggagtcgggcagcgctggcagtttggtggaggaataaac
actatctcttactgtaaccaagggtgtgcaaactcctggctggccgataagttctgtgac
caggcctgcaacgtcctgtcctgtgggtttgatgctggcgactgtggacaagatcatttt
catgaattgtataaagtaacacttctcccaaaccagactcactatgttgtccccaaaggt
gaatacctgtcttatttcagctttgcaaacatagccaaaagaggcgttgaggggacctac
agtgacaaccccatcgtccgtcacgcgtctatcgcaaacaagtggaaaaccatacacctc
ataatgcacagtgggatgaacgcaaccacgatctattttaacctcacccttcaaaactca
aacgatgaagagttcaaaatccagatagcagtagaggtggacacgagggaggtgcctaaa
ccgaactccacaacccagaagacctatgacaatttggttagcccagtgacacctcttcct
caggctgacgtcccttttgaagatgttcccaaagagaaacgcttccccagggtcaggaga
cctgatgtaaacgcaacagggaaagtccaggaggaggtgaaaatcccccgggtgaatatt
tccctccttcccaaagaggcccaggtgaggctgagcaacctggattcgcaactggaacgt
ggagacatcactctgaaaggatacaacttgtccaagtcagccctgctgagacctttcctg
aggaattcactagatactaaaggaaaacctcaagctgggacagatgagacaaaagacaac
ctggaggtcccacaggaagacccctctcaccaacgtccacgtggctttgctgccgcacgc
agaccagagaggtggacgaccccagcggagacagcgactgtgaacggtcgtgaccacggt
ttgaatccacccccgacccaacctgtgcccaaagagaacctctcaccactgatcattccc
ccagaaggccgcatgccaaaggaaggggacagagacagagcagagggcaatgctgatagc
cacgtacctgtaaacgagctggtgcctggcaggaggctacagcagcacatacccagttac
ccaggctttttgccctgggagaaaaacaagtatttccaagaccttcttgatgaggaagag
tcattaaagaaacagttggcgtactttactgacagcagacatgcggggagacaactaaaa
gatacgtttgcagactccctccgatacgtcaataaaattctcaatagcaagtttggattc
acatccaggaaagtccccgcacacatgccacacatgatcgacaggatcgttatgcaagaa
ctacaagatatgttccctgaagagtttgacaagacgtcatttcacaaggtgcgtcactct
gaggacatgcagtttgccttctcctatttctattacctcatgagtgcagttcagcccctg
aatctctctcaagtctttgatgaagttgatacagaccaatccggtgtcctgtcagataga
gaaatccgaacactggccacaagagttcacgatctacctttaagtctgcaggatttgaca
ggtttggaacacatgttgataaactgctcaaagctgctccctgctaatatcactcaacta
agcaacatcccaccaactcaggaagcgtactatgaccccaatctgccgccggtcactaag
agtcttgtcaccaattgcaagccggtaactgacaagatccacaaagcatataaagacaag
aacaaatacaggtttgaaatcatgggagaggaagaaatcgctttcaagatgatacgtacc
aatgtttctcatgtggttggccagttggatgacatcagaaaaaaccccagccctagctat
cctggaattctccctgtagaccaggctaccctcaaactcaagagatctgcccgcctctgc
cccgccagtgctgagattaaaggtatgcgccaccacgctgtcctgtctgtgacttctaaa
gttgttcctgcatcctctttctttttcccagaattgtag

DBGET integrated database retrieval system