KEGG   Rattus norvegicus (rat): 287155Help
Entry
287155            CDS       T01003                                 

Gene name
Stub1, Chip
Definition
(RefSeq) STIP1 homology and U-box containing protein 1
  KO
K09561  STIP1 homology and U-box containing protein 1 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    287155 (Stub1)
   04120 Ubiquitin mediated proteolysis
    287155 (Stub1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    287155 (Stub1)
   04131 Membrane trafficking [BR:rno04131]
    287155 (Stub1)
   04121 Ubiquitin system [BR:rno04121]
    287155 (Stub1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     287155 (Stub1)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Others
   287155 (Stub1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    287155 (Stub1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  U-box type E3
   287155 (Stub1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: U-box CHIP_TPR_N TPR_1 TPR_2 ANAPC3 TPR_16 TPR_8 TPR_12 TPR_11 TPR_17 TPR_19 TPR_14 TPR_9 zf-NOSIP
Motif
Other DBs
NCBI-GeneID: 287155
NCBI-ProteinID: NP_001020796
RGD: 1306167
Ensembl: ENSRNOG00000019798
UniProt: D4A4T0
Position
10q12
AA seq 304 aa AA seqDB search
MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLV
AVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQR
AYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEE
CQRNHEGDEDDGHIRAQQACIEAKHDKYMADMNELFSQVDEKRKKRDIPDYLCGKISFEL
MREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGW
VEDY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcaaggaggaaaaggagggcggcgcgcggctgggcactggtggcggcggcagc
cctgataagagcccgagtgcgcaagagctcaaggagcagggaaaccggctcttcgtgggc
cgcaagtacccggaggcggcggcctgctacggccgcgccatcacccggaacccacttgtg
gcagtgtactacaccaaccgggccctgtgctatctgaagatgcagcagcctgaacaggca
cttgctgactgccggagagccctggagctggatgggcagtctgtgaaggcgcacttcttc
ctggggcagtgccagctagagatggagagttatgatgaggccattgccaatctgcagcga
gcctatagtttggccaaggagcagcgactcaactttggggatgatattcctagtgccctt
cgcattgctaagaagaagcgctggaacagtatcgaggaacggcgcatccaccaggagagt
gagctgcactcctatctcaccaggctcattgctgctgagcgagagagggaactggaagag
tgtcagcggaaccacgagggtgatgaggatgatggccacatcagggcccagcaggcctgc
attgaggccaagcacgataaatacatggcggacatgaatgagctcttctctcaggtggat
gagaaaagaaagaagcgagatatccctgactacttgtgtggcaagatcagctttgagctg
atgcgggaaccctgcattacacccagtggcatcacctatgaccgcaaggacattgaggag
cacctgcagcgcgtgggccatttcgatcctgtgacccggagccctctgacccaggaacag
ctcatccccaacttagccatgaaggaagtcattgatgctttcatctctgagaatggctgg
gtagaggactactga

DBGET integrated database retrieval system