KEGG   Rattus norvegicus (rat): 287168Help
Entry
287168            CDS       T01003                                 

Gene name
Hbz, Glne1, RGD1307486
Definition
(RefSeq) hemoglobin subunit zeta
  KO
K13826  hemoglobin subunit zeta
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    287168 (Hbz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin
Motif
Other DBs
NCBI-GeneID: 287168
NCBI-ProteinID: NP_001166316
RGD: 1307486
Ensembl: ENSRNOG00000020536
UniProt: G3V8R3
Position
10q12
AA seq 142 aa AA seqDB search
MSLMKNERAIIMSMWDKMAPHAEPIGTETLERLFSSYPQTKTYFPHFDLHHGSQQLRAHG
SKILAAVGDAVKNIDNLSGALTKLSELHAYILRVDPVNFKLLSHCLLVTLAAHFPADFTP
EVHEAWDKFMSILSSVLTEKYR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgatgaagaatgagagagctatcatcatgtccatgtgggacaaaatggcgcct
catgcagagcccattggcactgagactctggagaggctcttcagcagctacccccagacg
aagacctacttcccacacttcgacctgcaccatgggtctcagcagttgcgtgcccacggc
tccaagatcttggccgctgtgggtgatgcggttaagaacatcgacaacctctctggtgct
ttgactaagttgagcgagctacacgcctacatcctgcgtgtggacccggtcaacttcaag
ctcctgtctcactgtctgctggtcacactggctgcacacttccccgccgactttacccct
gaggtccacgaagcttgggacaagttcatgtccatcctgtcttctgtcctgactgagaag
taccgctaa

DBGET integrated database retrieval system