KEGG   Rattus norvegicus (rat): 287173Help
Entry
287173            CDS       T01003                                 

Gene name
Bod1, Fam44b, RGD1305622
Definition
(RefSeq) biorientation of chromosomes in cell division 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: COMPASS-Shg1
Motif
Other DBs
NCBI-GeneID: 287173
NCBI-ProteinID: NP_001013876
RGD: 1305622
Ensembl: ENSRNOG00000020717
UniProt: Q6AYJ2 A0A0H2UHS5
Position
10q12
AA seq 237 aa AA seqDB search
MQRSLVTLLDERQQRGQRGAPWSSPPPTLPPPSPPPPWGPPCLRSAAHGSRRSSRARGRA
RGAAMADSAGAGAAGQASGPAGGSSGAGGTVNPASLPPGDPQLIALIVEQLKSRGLFDSF
RRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPAMNKNQLRNGLRQSVVQSGMLEAG
VDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKEAVPAPPPEPEGQDPPAPSQDAS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggtcgttggtgacgctattagacgagcgccagcagcgcggccagcggggagcg
ccgtggtcctcgccgcctcccaccctgccgcctccgtcgccgccacctccgtggggccct
ccgtgtctgcgcagcgcggcccacggctcccggaggagcagccgagcacggggtcgggca
cggggcgcagccatggcggacagtgcgggagcaggtgcggcgggccaggcctcgggacca
gcggggggctcgagtggggcgggcggcacggtcaaccccgcttcgctgcctccgggagac
ccgcagctcatcgctcttatagtggagcagctcaagagccgtggcctgtttgatagcttc
cgccgggactgcctggccgacgtggacactaagccagcttaccagaacctgaggcagaag
gtggataattttgtatcgacacatctggacaaacaggaatggaatcctgcaatgaacaag
aaccagctgcgaaatgggctgaggcagagcgtggttcagtcaggcatgttggaagcggga
gtggacaggatcatttctcaagtggtcgaccccaaactaaaccacatcttcaggccacag
atagagcgagcaatccacgagttcctggccgcccagaaaaaagaagctgtgccagctccc
cctccagaacctgaaggccaggatcctccagcgccatcccaagatgcttcctaa

DBGET integrated database retrieval system