KEGG   Rattus norvegicus (rat): 287199
Entry
287199            CDS       T01003                                 

Gene name
Nudcd2, RGD1307203
Definition
(RefSeq) NudC domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: CS DUF3110
Other DBs
NCBI-GeneID: 287199
NCBI-ProteinID: NP_001009621
RGD: 1307203
Ensembl: ENSRNOG00000060914
UniProt: Q5M823
Position
10q12
AA seq 157 aa
MSAPFEERSGVVPCATPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALAVGGRE
ILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQR
KLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtctgccccgtttgaggagcgcagcggggtagttccctgcgcgactccgtggggacag
tggtaccagaccctggaggaggtgtttattgaagtccaggtgcccccgggcactcgcgcg
caggacatccagtgtggcctgcagagtcggcacgtggctctggccgtgggtggccgcgag
atcctcaaggggaaattgtttgactctacaattgctgatgaaggaacatggactttggag
gatagaaagatggtccgcatcgtcctgacaaaaaccaagagagatgctgcaaactgttgg
acttcccttctagaatctgaatatgcagccgacccctgggtgcaagaccaaatgcagagg
aaacttacgttagagcgattccagaaagagaatcctgggtttgactttagtggagcagaa
atctcagggaactacacaaaaggtggaccagatttctcaaaccttgagaaatga

DBGET integrated database retrieval system